Diaphorina citri psyllid: psy1440

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
NKAVKSYWENYLLAYTAGQGPIKDVYNIGENPQFRLEVGGGVGAVWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKRPQASWSAGQGPIKDVYNIGENPQFRLEVGGGVGAVWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEE
cccccEEEEEEEEEEcccccccccccccccccEEEEEEcccccEEEEEEEEcccccccccccccEEEEEEEEccccEEEccccccccccccEEccccEEEEEECccccccEEEEEEEEEccccEEEEEEEEEEccccCEEEccccccccccccccccccccccccEEEEECcccccEEEEEEEccccccccccccEEEEEEEEECccCEEEcccccccccccCECccccEEEEEECcccccccEEEEEccccccccccEEEEEEEcccEEEEEccccccEEcc
NKAVKSYWENYLLAYTAGQGPIKDVYNIGENPQFRLEVGGGVGAVWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKRPQASWSAGQGPIKDVYNIGENPQFRLEVGGGVGAVWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPY*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NKAVKSYWENYLLAYTAGQGPIKDVYNIGENPQFRLEVGGGVGAVWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKRPQASWSAGQGPIKDVYNIGENPQFRLEVGGGVGAVWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calpain-7 Calcium-regulated non-lysosomal thiol-protease.confidentQ9R1S8
Calpain-7 Calcium-regulated non-lysosomal thiol-protease.confidentA0FKG7
Calpain-7 Calcium-regulated non-lysosomal thiol-protease.confidentQ9Y6W3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097264 [BP]self proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0006508
GO:0090541 [MF]MIT domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QXP, chain A
Confidence level:very confident
Coverage over the Query: 2-141
View the alignment between query and template
View the model in PyMOL
Template: 1QXP, chain A
Confidence level:very confident
Coverage over the Query: 142-279
View the alignment between query and template
View the model in PyMOL