Psyllid ID: psy14425


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MAGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRSVGHELK
ccccEEEEEEEEccccccHHHHHHHHccccccccEEEEEEcccEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
ccccEEEEEEEccHHHHHHHHHHHcccccccEEEEEEEEccccEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccEEEHccccEEEEEccccccEcEccc
MAGIVVVLEIMSREASGNLLsahyrldshphinsLHEVLLGDklaylvfppcsgdlhSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCnaqrsvghelk
MAGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQgivlrdlklrKFVFCnaqrsvghelk
MAGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRSVGHELK
***IVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNA*********
*AGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQ********
MAGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQ********
*AGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRSV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRSVGHELK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q8K4K2 354 Tribbles homolog 3 OS=Mus yes N/A 0.938 0.302 0.439 2e-19
Q9WTQ6 349 Tribbles homolog 3 OS=Rat yes N/A 0.938 0.306 0.429 7e-19
Q8K4K4 372 Tribbles homolog 1 OS=Mus no N/A 0.780 0.239 0.516 1e-18
Q8K4K3 343 Tribbles homolog 2 OS=Mus no N/A 0.894 0.297 0.457 2e-18
Q96RU8 372 Tribbles homolog 1 OS=Hom yes N/A 0.780 0.239 0.505 3e-18
Q92519 343 Tribbles homolog 2 OS=Hom no N/A 0.780 0.259 0.483 5e-18
Q5GLH2 343 Tribbles homolog 2 OS=Bos yes N/A 0.780 0.259 0.483 5e-18
Q5R669 343 Tribbles homolog 2 OS=Pon no N/A 0.780 0.259 0.483 5e-18
Q28283 343 Tribbles homolog 2 OS=Can no N/A 0.780 0.259 0.483 5e-18
Q96RU7 358 Tribbles homolog 3 OS=Hom no N/A 0.780 0.248 0.471 2e-15
>sp|Q8K4K2|TRIB3_MOUSE Tribbles homolog 3 OS=Mus musculus GN=Trib3 PE=1 SV=2 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 65/107 (60%)

Query: 2   AGIVVVLEIMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVR 61
            G     ++     +  +L+ + RL +H H+    EVLLG +L Y+ F    GDLHS VR
Sbjct: 90  TGTEYTCKVYPASEAQAVLAPYARLPTHQHVARPTEVLLGSRLLYIFFTKTHGDLHSLVR 149

Query: 62  QRKRLKEAEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQRS 108
            R+ + E+EA  LFRQ+A  V  CH  G+VLRDLKLR+FVF N +R+
Sbjct: 150 SRRGIPESEAAGLFRQMASAVAHCHKHGLVLRDLKLRRFVFSNCERT 196




Disrupts insulin signaling by binding directly to Akt kinases and blocking their activation. May bind directly to and mask the 'Thr-308' phosphorylation site in AKT1. Binds to ATF4 and inhibits its transcriptional activation activity. Interacts with the NF-kappa-B transactivator p65 RELA and inhibits its phosphorylation and thus its transcriptional activation activity. Interacts with MAPK kinases and regulates activation of MAP kinases. May play a role in programmed neuronal cell death but does not appear to affect non-neuronal cells. Does not display kinase activity.
Mus musculus (taxid: 10090)
>sp|Q9WTQ6|TRIB3_RAT Tribbles homolog 3 OS=Rattus norvegicus GN=Trib3 PE=2 SV=1 Back     alignment and function description
>sp|Q8K4K4|TRIB1_MOUSE Tribbles homolog 1 OS=Mus musculus GN=Trib1 PE=2 SV=2 Back     alignment and function description
>sp|Q8K4K3|TRIB2_MOUSE Tribbles homolog 2 OS=Mus musculus GN=Trib2 PE=2 SV=2 Back     alignment and function description
>sp|Q96RU8|TRIB1_HUMAN Tribbles homolog 1 OS=Homo sapiens GN=TRIB1 PE=1 SV=2 Back     alignment and function description
>sp|Q92519|TRIB2_HUMAN Tribbles homolog 2 OS=Homo sapiens GN=TRIB2 PE=2 SV=1 Back     alignment and function description
>sp|Q5GLH2|TRIB2_BOVIN Tribbles homolog 2 OS=Bos taurus GN=TRIB2 PE=2 SV=1 Back     alignment and function description
>sp|Q5R669|TRIB2_PONAB Tribbles homolog 2 OS=Pongo abelii GN=TRIB2 PE=2 SV=1 Back     alignment and function description
>sp|Q28283|TRIB2_CANFA Tribbles homolog 2 OS=Canis familiaris GN=TRIB2 PE=2 SV=1 Back     alignment and function description
>sp|Q96RU7|TRIB3_HUMAN Tribbles homolog 3 OS=Homo sapiens GN=TRIB3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
242019356108 ser/thr protein kinase-trb3, putative [P 0.850 0.898 0.717 5e-33
357624851198 putative tribbles-like protein 2 [Danaus 0.877 0.505 0.693 5e-33
91082437 343 PREDICTED: similar to tribbles homolog 2 0.894 0.297 0.631 3e-31
270007157 343 hypothetical protein TcasGA2_TC013693 [T 0.868 0.288 0.65 5e-31
157116640 302 serine/threonine protein kinase, putativ 0.850 0.321 0.608 9e-30
170039881 294 serine/threonine protein kinase [Culex q 0.850 0.329 0.608 2e-29
312371261 1009 hypothetical protein AND_22330 [Anophele 0.798 0.090 0.604 5e-28
318087012191 putative serine/threonine protein kinase 0.885 0.528 0.524 5e-24
427778579 341 Putative tribbles log 2 [Rhipicephalus p 0.780 0.260 0.584 7e-23
427782983 341 Putative tribbles log 2 [Rhipicephalus p 0.780 0.260 0.584 8e-23
>gi|242019356|ref|XP_002430127.1| ser/thr protein kinase-trb3, putative [Pediculus humanus corporis] gi|212515218|gb|EEB17389.1| ser/thr protein kinase-trb3, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/99 (71%), Positives = 82/99 (82%), Gaps = 2/99 (2%)

Query: 10  IMSREASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPC-SGDLHSYVRQRKRLKE 68
           ++ REA G LLSAHYR+D HPH+NSL EVLLGDKL YLVFPP   GDLHS+VR RKRL+E
Sbjct: 11  VIGREAGG-LLSAHYRMDGHPHVNSLREVLLGDKLLYLVFPPSKGGDLHSHVRLRKRLRE 69

Query: 69  AEARKLFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQR 107
             ARKLFRQ+  TV+ACH +GIVLRDLKLRKFVF + Q+
Sbjct: 70  PVARKLFRQMVNTVKACHDKGIVLRDLKLRKFVFSDTQK 108




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357624851|gb|EHJ75467.1| putative tribbles-like protein 2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91082437|ref|XP_970911.1| PREDICTED: similar to tribbles homolog 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270007157|gb|EFA03605.1| hypothetical protein TcasGA2_TC013693 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157116640|ref|XP_001658589.1| serine/threonine protein kinase, putative [Aedes aegypti] gi|108876372|gb|EAT40597.1| AAEL007688-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170039881|ref|XP_001847748.1| serine/threonine protein kinase [Culex quinquefasciatus] gi|167863469|gb|EDS26852.1| serine/threonine protein kinase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312371261|gb|EFR19494.1| hypothetical protein AND_22330 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|318087012|gb|ADV40098.1| putative serine/threonine protein kinase [Latrodectus hesperus] Back     alignment and taxonomy information
>gi|427778579|gb|JAA54741.1| Putative tribbles log 2 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427782983|gb|JAA56943.1| Putative tribbles log 2 [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
ZFIN|ZDB-GENE-091207-3 343 trib2 "tribbles homolog 2 (Dro 0.780 0.259 0.539 1.3e-20
MGI|MGI:1345675 354 Trib3 "tribbles homolog 3 (Dro 0.789 0.254 0.511 1.3e-19
UNIPROTKB|F1NV51 281 TRIB2 "Uncharacterized protein 0.929 0.377 0.452 3.1e-19
UNIPROTKB|Q7ZZY2 343 TRIB2 "Uncharacterized protein 0.938 0.311 0.448 3.1e-19
RGD|708432 349 Trib3 "tribbles homolog 3 (Dro 0.789 0.257 0.5 6e-19
UNIPROTKB|Q9WTQ6 349 Trib3 "Tribbles homolog 3" [Ra 0.789 0.257 0.5 6e-19
MGI|MGI:2443397 372 Trib1 "tribbles homolog 1 (Dro 0.754 0.231 0.534 7.3e-19
UNIPROTKB|Q96RU8 372 TRIB1 "Tribbles homolog 1" [Ho 0.754 0.231 0.523 1.6e-18
UNIPROTKB|I3L6J0 263 TRIB1 "Uncharacterized protein 0.745 0.323 0.529 1.7e-18
UNIPROTKB|I3LNA0 271 TRIB1 "Uncharacterized protein 0.745 0.313 0.529 1.7e-18
ZFIN|ZDB-GENE-091207-3 trib2 "tribbles homolog 2 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 1.3e-20, P = 1.3e-20
 Identities = 48/89 (53%), Positives = 63/89 (70%)

Query:    20 LSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIA 79
             L+A++ L +H +IN + E+LLGD  AY+ F    GD+HS+VR  K+L+E EA +LF QIA
Sbjct:   101 LAAYFVLGTHENINQIVEILLGDTRAYVFFERSHGDMHSFVRTCKKLREEEAARLFHQIA 160

Query:    80 ETVRACHAQGIVLRDLKLRKFVFCNAQRS 108
               V  CH  G+VLRDLKLRKFVF N  R+
Sbjct:   161 SAVAHCHDNGLVLRDLKLRKFVFKNEDRN 189




GO:0005524 "ATP binding" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IEA
MGI|MGI:1345675 Trib3 "tribbles homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV51 TRIB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ZZY2 TRIB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|708432 Trib3 "tribbles homolog 3 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9WTQ6 Trib3 "Tribbles homolog 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443397 Trib1 "tribbles homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96RU8 TRIB1 "Tribbles homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6J0 TRIB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNA0 TRIB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96RU8TRIB1_HUMANNo assigned EC number0.50560.78070.2392yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-15
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 9e-15
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-14
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 4e-12
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-11
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-09
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 3e-08
cd08530 256 cd08530, STKc_CNK2-like, Catalytic domain of the P 6e-08
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 3e-07
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 5e-07
cd07831 282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-06
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 3e-06
PHA03209 357 PHA03209, PHA03209, serine/threonine kinase US3; P 4e-06
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 5e-06
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 9e-06
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-05
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 1e-05
cd08215 258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-05
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 1e-05
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 1e-05
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 2e-05
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 3e-05
PHA03211 461 PHA03211, PHA03211, serine/threonine kinase US3; P 4e-05
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 6e-05
cd07847 286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 6e-05
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 6e-05
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 1e-04
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-04
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-04
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-04
PHA03390 267 PHA03390, pk1, serine/threonine-protein kinase 1; 2e-04
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 3e-04
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-04
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 3e-04
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 4e-04
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 4e-04
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 5e-04
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 5e-04
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 6e-04
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 7e-04
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 7e-04
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 7e-04
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 0.001
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 0.001
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 0.002
PLN03225 566 PLN03225, PLN03225, Serine/threonine-protein kinas 0.002
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 0.002
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 0.002
PHA03212 391 PHA03212, PHA03212, serine/threonine kinase US3; P 0.002
cd05583 288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 0.002
cd05613 290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 0.003
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 0.004
cd08223 257 cd08223, STKc_Nek4, Catalytic domain of the Protei 0.004
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 0.004
cd07872 309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score = 69.1 bits (170), Expect = 2e-15
 Identities = 30/69 (43%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 29  HPHINSLHEVLLGDKLAYLVFPPCS-GDLHSYVRQRKRLKEAEARKLFRQIAETVRACHA 87
           HP+I  L++V   +   YLV   C  GDL   +++R RL E EAR   RQI   +   H+
Sbjct: 56  HPNIVRLYDVFEDEDKLYLVMEYCEGGDLFDLLKKRGRLSEDEARFYLRQILSALEYLHS 115

Query: 88  QGIVLRDLK 96
           +GIV RDLK
Sbjct: 116 KGIVHRDLK 124


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG0595|consensus 429 99.97
KOG0615|consensus 475 99.96
KOG0575|consensus 592 99.95
KOG0611|consensus 668 99.94
KOG0592|consensus 604 99.94
KOG0583|consensus 370 99.94
KOG0598|consensus 357 99.93
KOG0581|consensus 364 99.93
KOG0610|consensus 459 99.93
KOG0661|consensus 538 99.93
KOG0600|consensus 560 99.92
KOG0582|consensus 516 99.92
KOG0588|consensus 786 99.91
KOG0599|consensus 411 99.91
KOG0616|consensus 355 99.91
KOG0659|consensus 318 99.91
KOG0192|consensus 362 99.91
KOG0605|consensus 550 99.91
KOG0593|consensus 396 99.9
KOG0198|consensus 313 99.9
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.9
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.9
KOG0594|consensus 323 99.9
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.9
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.9
PHA03212 391 serine/threonine kinase US3; Provisional 99.9
KOG0586|consensus 596 99.89
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.89
KOG0607|consensus 463 99.89
KOG0585|consensus 576 99.89
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.89
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.89
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.89
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.89
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.89
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.89
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.89
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.89
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.89
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.89
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.89
KOG0663|consensus 419 99.88
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.88
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.88
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.88
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.88
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.88
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.88
KOG0032|consensus 382 99.88
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.88
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.88
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.88
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.88
KOG0597|consensus 808 99.88
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.88
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.88
KOG0660|consensus 359 99.88
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.88
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.88
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.88
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.88
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.88
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.88
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.88
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.88
KOG0580|consensus 281 99.88
KOG0658|consensus 364 99.87
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.87
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.87
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.87
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.87
KOG0197|consensus 468 99.87
KOG0578|consensus 550 99.87
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.87
KOG1187|consensus 361 99.87
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.87
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.87
KOG4721|consensus 904 99.87
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.86
KOG0604|consensus 400 99.86
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.86
KOG0591|consensus 375 99.86
KOG4717|consensus 864 99.86
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 99.86
PHA03207 392 serine/threonine kinase US3; Provisional 99.86
PTZ00267 478 NIMA-related protein kinase; Provisional 99.86
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.86
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.86
KOG0667|consensus 586 99.86
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.86
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.86
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.86
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.86
PHA03209 357 serine/threonine kinase US3; Provisional 99.85
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.85
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.85
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.85
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.85
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.85
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.85
PHA03211 461 serine/threonine kinase US3; Provisional 99.85
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.85
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.85
PHA02988 283 hypothetical protein; Provisional 99.85
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.85
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.85
KOG0694|consensus 694 99.85
KOG0589|consensus 426 99.85
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.85
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.85
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.85
KOG4250|consensus 732 99.85
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.85
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.85
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.85
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.85
KOG0194|consensus 474 99.85
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.85
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.85
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.85
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.85
PTZ00036 440 glycogen synthase kinase; Provisional 99.84
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.84
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 99.84
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.84
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.84
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.84
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.84
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.84
KOG0033|consensus 355 99.84
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.84
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.84
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.83
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.83
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.83
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.83
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.83
KOG0608|consensus 1034 99.83
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.83
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.83
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.83
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.83
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.83
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.83
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.83
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.83
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.83
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.83
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.83
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.83
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.83
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.83
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.83
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.83
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.83
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.83
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.83
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.83
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.83
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.83
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.82
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.82
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.82
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.82
KOG4236|consensus 888 99.82
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.82
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.82
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.82
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.82
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.82
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.82
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.82
PLN00009 294 cyclin-dependent kinase A; Provisional 99.82
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.82
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.82
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.82
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.82
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.82
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.82
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.82
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.82
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.82
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.82
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.82
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.82
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.82
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.82
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.82
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.82
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.82
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.82
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.82
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.82
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.82
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.82
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.82
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.81
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.81
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.81
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.81
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.81
KOG0662|consensus 292 99.81
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.81
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.81
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.81
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.81
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.81
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.81
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.81
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.81
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.81
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.81
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.81
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.81
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.81
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.81
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.81
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.81
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.81
KOG0666|consensus 438 99.81
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.81
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.81
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.81
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.81
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.81
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.81
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.81
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.81
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.81
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.81
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.81
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.81
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.81
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.81
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.81
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.81
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.8
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.8
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.8
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.8
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.8
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.8
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.8
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.8
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.8
KOG0612|consensus 1317 99.8
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.8
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.8
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.8
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.8
KOG1989|consensus 738 99.8
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.8
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.8
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.8
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.8
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.8
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.8
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.8
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.8
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.8
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.8
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.8
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.8
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 99.8
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.8
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.8
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.8
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.79
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.79
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.79
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.79
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.79
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.79
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.79
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.79
KOG0574|consensus 502 99.79
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.79
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.79
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.79
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.79
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.79
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.79
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.79
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.79
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.79
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.79
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.79
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.79
PTZ00284 467 protein kinase; Provisional 99.79
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.79
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.79
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.79
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.79
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.79
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.79
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.79
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.78
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.78
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.78
KOG1152|consensus772 99.78
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.78
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.78
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.78
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.78
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.78
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.78
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.78
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.78
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.78
PTZ00283 496 serine/threonine protein kinase; Provisional 99.78
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.78
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.78
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.78
KOG1094|consensus 807 99.78
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.78
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.78
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.77
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.77
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.77
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.77
KOG1026|consensus 774 99.77
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.77
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.77
KOG0668|consensus 338 99.77
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.77
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.77
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.77
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.77
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.77
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.77
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.77
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.77
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.77
KOG0690|consensus 516 99.76
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.76
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.76
KOG0584|consensus 632 99.76
KOG0193|consensus 678 99.76
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.76
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.76
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.76
KOG0201|consensus 467 99.76
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.76
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.76
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.76
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.75
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.75
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.75
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.75
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.75
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.75
KOG0603|consensus 612 99.75
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.75
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.74
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.74
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.74
KOG4645|consensus 1509 99.74
KOG1290|consensus 590 99.74
KOG0579|consensus 1187 99.74
KOG1095|consensus 1025 99.74
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.74
PRK10345210 hypothetical protein; Provisional 99.73
KOG0577|consensus 948 99.73
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.73
KOG0986|consensus 591 99.73
KOG0587|consensus 953 99.73
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.73
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.72
PHA03210 501 serine/threonine kinase US3; Provisional 99.72
KOG1027|consensus 903 99.71
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 99.71
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.71
KOG0696|consensus 683 99.7
KOG2345|consensus 302 99.7
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.7
KOG0614|consensus 732 99.7
KOG0596|consensus 677 99.69
KOG4279|consensus 1226 99.69
KOG0196|consensus 996 99.69
KOG0695|consensus 593 99.68
KOG3653|consensus 534 99.68
KOG0665|consensus 369 99.68
KOG2052|consensus 513 99.67
KOG0984|consensus282 99.67
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.67
KOG4257|consensus 974 99.66
KOG1167|consensus 418 99.66
KOG0983|consensus 391 99.66
KOG1151|consensus 775 99.65
PRK09188 365 serine/threonine protein kinase; Provisional 99.65
KOG0671|consensus 415 99.64
KOG1345|consensus 378 99.64
KOG4278|consensus 1157 99.64
KOG1163|consensus 341 99.64
KOG0199|consensus 1039 99.62
PRK14879211 serine/threonine protein kinase; Provisional 99.61
KOG0576|consensus 829 99.61
smart00090237 RIO RIO-like kinase. 99.61
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.6
KOG1165|consensus 449 99.6
KOG0669|consensus 376 99.6
KOG0200|consensus 609 99.59
PHA02882 294 putative serine/threonine kinase; Provisional 99.56
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.54
KOG0664|consensus 449 99.54
KOG1164|consensus 322 99.53
KOG1006|consensus 361 99.53
PRK12274218 serine/threonine protein kinase; Provisional 99.5
KOG0670|consensus 752 99.5
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.5
PLN00181 793 protein SPA1-RELATED; Provisional 99.5
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.48
KOG1025|consensus 1177 99.48
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.47
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.46
KOG1035|consensus 1351 99.44
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.42
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.33
KOG1166|consensus 974 99.32
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.31
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.29
KOG4158|consensus 598 99.21
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.16
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.14
KOG0590|consensus 601 99.13
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 99.11
KOG1240|consensus 1431 99.09
KOG3087|consensus229 99.05
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.96
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.91
KOG3741|consensus 655 98.9
KOG0603|consensus 612 98.89
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.83
KOG1243|consensus 690 98.82
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.78
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 98.78
KOG1024|consensus 563 98.74
smart00750 176 KIND kinase non-catalytic C-lobe domain. It is an 98.59
KOG1023|consensus 484 98.46
KOG0195|consensus 448 98.31
COG0478304 RIO-like serine/threonine protein kinase fused to 98.31
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.26
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.24
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 98.22
KOG0590|consensus 601 98.19
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.18
KOG0601|consensus 524 98.16
PRK09902216 hypothetical protein; Provisional 98.14
KOG1266|consensus 458 98.12
KOG0601|consensus 524 98.02
KOG1033|consensus 516 97.87
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.71
COG0661 517 AarF Predicted unusual protein kinase [General fun 97.62
cd05150 244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 97.58
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 97.24
KOG2270|consensus 520 97.14
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 96.94
KOG0606|consensus 1205 96.52
KOG1235|consensus 538 96.28
KOG1035|consensus 1351 95.35
KOG0606|consensus 1205 95.18
PRK10593 297 hypothetical protein; Provisional 94.88
PHA03111 444 Ser/Thr kinase; Provisional 94.58
COG5072 488 ALK1 Serine/threonine kinase of the haspin family 94.2
PLN02876 822 acyl-CoA dehydrogenase 93.51
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 93.27
PF05445 434 Pox_ser-thr_kin: Poxvirus serine/threonine protein 92.84
PF01636239 APH: Phosphotransferase enzyme family This family 92.24
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 91.62
KOG0576|consensus 829 91.47
COG4248 637 Uncharacterized protein with protein kinase and he 91.45
PRK05231 319 homoserine kinase; Provisional 89.1
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 88.37
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 87.28
PF01636239 APH: Phosphotransferase enzyme family This family 87.26
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 86.74
KOG2268|consensus 465 86.55
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 86.43
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 86.13
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 85.94
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 85.84
COG3001 286 Uncharacterized protein conserved in bacteria [Fun 85.22
PRK12396 409 5-methylribose kinase; Reviewed 84.86
PRK10271188 thiK thiamine kinase; Provisional 84.78
PF07387 308 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR0099 84.19
KOG2464|consensus246 83.01
PTZ00384 383 choline kinase; Provisional 83.0
KOG2137|consensus 700 82.45
KOG1236|consensus 565 82.42
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme 81.81
cd05156 302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 81.32
TIGR01767 370 MTRK 5-methylthioribose kinase. This enzyme is inv 80.79
>KOG0595|consensus Back     alignment and domain information
Probab=99.97  E-value=2.6e-29  Score=163.48  Aligned_cols=103  Identities=31%  Similarity=0.557  Sum_probs=95.5

Q ss_pred             CCcEEEEEEecccc--------chhHHHHHhhhCCCCCcceEEEEEEcCCEEEEEecCC-CCCHHHHHHhCCCCCHHHHH
Q psy14425          2 AGIVVVLEIMSREA--------SGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPC-SGDLHSYVRQRKRLKEAEAR   72 (114)
Q Consensus         2 t~~~~avK~~~~~~--------~~~e~~~~~~~~~h~~i~~~~~~~~~~~~~~~v~e~~-~~~l~~~~~~~~~~~~~~~~   72 (114)
                      ++..||||.+.+..        ...|+.++..+ +|||||.+++++++++++|+||||| +|+|.+++...+.+++.+++
T Consensus        34 ~~~~VAIK~i~~~~l~~k~~e~L~~Ei~iLkel-~H~nIV~l~d~~~~~~~i~lVMEyC~gGDLs~yi~~~~~l~e~t~r  112 (429)
T KOG0595|consen   34 SGTEVAIKCIAKKKLNKKLVELLLSEIKILKEL-KHPNIVRLLDCIEDDDFIYLVMEYCNGGDLSDYIRRRGRLPEATAR  112 (429)
T ss_pred             CCceEEeeeehhhccCHHHHHHHHHHHHHHHhc-CCcceeeEEEEEecCCeEEEEEEeCCCCCHHHHHHHcCCCCHHHHH
Confidence            57899999997663        23588889888 9999999999999999999999999 89999999998999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCccCCCCCCcEEEecC
Q psy14425         73 KLFRQIAETVRACHAQGIVLRDLKLRKFVFCNA  105 (114)
Q Consensus        73 ~~~~~~~~~l~~lh~~~i~h~~lk~~nil~~~~  105 (114)
                      .++.|++.|+++||+++|+||||||+|||++..
T Consensus       113 ~Fm~QLA~alq~L~~~~IiHRDLKPQNiLLs~~  145 (429)
T KOG0595|consen  113 HFMQQLASALQFLHENNIIHRDLKPQNILLSTT  145 (429)
T ss_pred             HHHHHHHHHHHHHHHCCeeeccCCcceEEeccC
Confidence            999999999999999999999999999999765



>KOG0615|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG2270|consensus Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1235|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PHA03111 Ser/Thr kinase; Provisional Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>KOG2268|consensus Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length Back     alignment and domain information
>KOG2464|consensus Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG1236|consensus Back     alignment and domain information
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
3dae_A 283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 3e-09
3hyh_A 275 Crystal Structure Of The Protein Kinase Domain Of Y 3e-09
3mn3_A 271 An Inhibited Conformation For The Protein Kinase Do 3e-09
2fh9_A 274 Structure And Dimerization Of The Kinase Domain Fro 3e-09
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-09
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 4e-09
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-09
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 5e-09
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-09
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 5e-09
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 5e-09
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 6e-09
3h4j_B 336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 8e-09
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 2e-08
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-08
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 5e-08
2h6d_A 276 Protein Kinase Domain Of The Human 5'-Amp-Activated 2e-07
2yza_A 276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 2e-07
2vn9_A 301 Crystal Structure Of Human Calcium Calmodulin Depen 3e-07
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 3e-07
2wel_A 327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-07
2bdw_A 362 Crystal Structure Of The Auto-Inhibited Kinase Doma 7e-07
3kl8_A 269 Camkiintide Inhibitor Complex Length = 269 3e-06
3kk8_A 284 Camkii Substrate Complex A Length = 284 4e-06
3kk9_A 282 Camkii Substrate Complex B Length = 282 4e-06
3soa_A 444 Full-Length Human Camkii Length = 444 5e-06
2phk_A 277 The Crystal Structure Of A Phosphorylase Kinase Pep 9e-06
2vz6_A 313 Structure Of Human Calcium Calmodulin Dependent Pro 1e-05
1ql6_A 298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-05
1phk_A 298 Two Structures Of The Catalytic Domain Of Phosphory 1e-05
2y7j_A 365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 2e-05
3kn5_A 325 Crystal Structure Of The C-Terminal Kinase Domain O 2e-05
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 2e-05
3bhh_A 295 Crystal Structure Of Human Calcium/calmodulin-depen 2e-05
3f3z_A 277 Crystal Structure Of Cryptosporidium Parvum Calcium 3e-05
2qg5_A 294 Cryptosporidium Parvum Calcium Dependent Protein Ki 3e-05
2qr8_A 342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 4e-05
2qr7_A 342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 4e-05
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 4e-05
3uc4_A 362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 4e-05
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 4e-05
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 5e-05
1yhs_A 273 Crystal Structure Of Pim-1 Bound To Staurosporine L 5e-05
3cek_A 313 Crystal Structure Of Human Dual Specificity Protein 5e-05
3h9f_A 313 Crystal Structure Of Human Dual Specificity Protein 6e-05
3mfr_A 351 Cask-4m Cam Kinase Domain, Native Length = 351 6e-05
2x9e_A 317 Human Mps1 In Complex With Nms-P715 Length = 317 6e-05
3vqu_A 320 Crystal Structure Of Human Mps1 Catalytic Domain In 7e-05
3hmn_A 342 Crystal Structure Of Human Mps1 Catalytic Domain In 7e-05
3rny_A 346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 7e-05
2v7o_A 336 Crystal Structure Of Human Calcium-Calmodulin-Depen 9e-05
3db6_A 301 Crystal Structure Of An Activated (Thr->asp) Polo-L 9e-05
3cok_A 278 Crystal Structure Of Plk4 Kinase Length = 278 9e-05
2wnt_A 330 Crystal Structure Of The Human Ribosomal Protein S6 1e-04
3d5w_A 317 Crystal Structure Of A Phosphorylated Polo-Like Kin 1e-04
3d5v_A 317 Crystal Structure Of An Activated (Thr->asp) Polo-L 1e-04
3d5u_A 317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 1e-04
4as0_A 273 Cyclometalated Phthalimides As Protein Kinase Inhib 1e-04
3jpv_A 313 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-04
3ma3_A 313 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-04
2j2i_B 312 Crystal Structure Of The Humab Pim1 In Complex With 1e-04
3c4e_A 273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 1e-04
4a7c_A 308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 1e-04
3cxw_A 314 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-04
4alv_A 328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 1e-04
2bik_B 313 Human Pim1 Phosphorylated On Ser261 Length = 313 1e-04
3uix_A 298 Crystal Structure Of Pim1 Kinase In Complex With Sm 1e-04
3a99_A 320 Structure Of Pim-1 Kinase Crystallized In The Prese 1e-04
2obj_A 333 Crystal Structure Of Human Pim-1 Kinase In Complex 1e-04
2bil_B 313 The Human Protein Kinase Pim1 In Complex With Its C 1e-04
3cy3_A 314 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-04
4dtk_A 276 Novel And Selective Pan-Pim Kinase Inhibitor Length 1e-04
3dcv_A 328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 1e-04
2xiy_A 301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 1e-04
2xj0_A 301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 1e-04
1xqz_A 300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 1e-04
2xix_A 301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 1e-04
3jxw_A 294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 1e-04
3f2a_A 300 Crystal Structure Of Human Pim-1 In Complex With Da 1e-04
1xws_A 313 Crystal Structure Of The Human Pim1 Kinase Domain L 1e-04
1ywv_A 293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 1e-04
4alu_A 328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 1e-04
1yxs_A 293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 1e-04
3r00_A 299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 1e-04
3c0g_A 351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 2e-04
3tac_A 361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 2e-04
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-04
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 3e-04
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 3e-04
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-04
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 3e-04
3ma6_A 298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 3e-04
2iwi_A 312 Crystal Structure Of The Human Pim2 In Complex With 3e-04
3dbq_A 343 Crystal Structure Of Ttk Kinase Domain Length = 343 6e-04
2zmd_A 390 Crystal Structure Of Human Mps1 Catalytic Domain T6 6e-04
2zmc_A 390 Crystal Structure Of Human Mitotic Checkpoint Kinas 6e-04
3dfa_A 286 Crystal Structure Of Kinase Domain Of Calcium-depen 6e-04
2wei_A 287 Crystal Structure Of The Kinase Domain Of Cryptospo 6e-04
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 7e-04
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 7e-04
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 7e-04
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 7e-04
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure

Iteration: 1

Score = 57.0 bits (136), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 29/75 (38%), Positives = 41/75 (54%) Query: 22 AHYRLDSHPHINSLHEVLLGDKLAYLVFPPCSGDLHSYVRQRKRLKEAEARKLFRQIAET 81 ++ RL HPHI L++V+ +V +L Y+ QR ++ E EAR+ F+QI Sbjct: 66 SYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISA 125 Query: 82 VRACHAQGIVLRDLK 96 V CH IV RDLK Sbjct: 126 VEYCHRHKIVHRDLK 140
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-19
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 1e-18
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 1e-18
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 1e-18
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-18
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 2e-18
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-18
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 4e-18
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 8e-18
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 9e-18
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-17
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-17
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 2e-17
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 2e-17
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 2e-17
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 2e-17
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 3e-17
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-17
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 4e-17
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-17
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 5e-17
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 6e-17
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 6e-17
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 7e-17
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 1e-16
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-16
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 1e-16
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 3e-16
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 4e-16
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 7e-16
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 9e-16
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-15
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 1e-15
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 2e-15
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-15
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 2e-15
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-15
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 4e-15
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 4e-15
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 5e-15
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 7e-15
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 7e-15
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 8e-15
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 8e-15
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 8e-15
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 1e-14
3bhy_A 283 Death-associated protein kinase 3; death associate 1e-14
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 1e-14
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 1e-14
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 2e-14
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 3e-14
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-14
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 5e-14
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 6e-14
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-13
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 4e-13
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 7e-13
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 2e-12
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-12
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 3e-12
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 8e-12
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-11
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 2e-11
3o0g_A 292 Cell division protein kinase 5; kinase activator c 2e-11
3niz_A 311 Rhodanese family protein; structural genomics, str 2e-11
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 2e-11
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 3e-11
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-11
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 6e-11
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 6e-11
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 1e-10
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 2e-10
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 3e-10
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 3e-10
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 3e-10
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 4e-10
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 6e-10
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 1e-09
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 2e-09
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 6e-09
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 8e-09
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 2e-08
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 4e-08
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-08
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-08
2a19_B 284 Interferon-induced, double-stranded RNA-activated 5e-08
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 6e-08
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 6e-08
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-07
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 1e-07
3ork_A 311 Serine/threonine protein kinase; structural genomi 4e-07
3uqc_A 286 Probable conserved transmembrane protein; structur 8e-07
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-06
3rp9_A 458 Mitogen-activated protein kinase; structural genom 3e-05
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 3e-05
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 3e-05
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-05
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 1e-04
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 1e-04
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 3e-04
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-04
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 3e-04
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-04
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 5e-04
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 5e-04
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 8e-04
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 8e-04
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 9e-04
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
 Score = 80.4 bits (199), Expect = 1e-19
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 28  SHPHINSLHEVLLGDKLAYLVFP-PCSG-DLHSYVRQRKRLKEAEARKLFRQIAETVRAC 85
            HP +  L +     +   LV   P    DL  Y+ ++  L E  +R  F Q+   ++ C
Sbjct: 96  GHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHC 155

Query: 86  HAQGIVLRDLKL 97
           H++G+V RD+K 
Sbjct: 156 HSRGVVHRDIKD 167


>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.97
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.97
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.97
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.97
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.97
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.97
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.97
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.96
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.96
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.96
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.96
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.95
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.95
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.95
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.94
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.94
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.94
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.94
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.94
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.93
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.92
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.92
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.92
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.92
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.92
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.92
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.92
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.92
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.92
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.92
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.91
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.91
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.91
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.91
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.91
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.91
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.91
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.91
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.91
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.91
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.91
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.91
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.91
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.91
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.91
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.9
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.9
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.9
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.9
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.9
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.9
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.9
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.9
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.9
3uqc_A 286 Probable conserved transmembrane protein; structur 99.9
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.9
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.9
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.9
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.9
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.9
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.9
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.9
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.9
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.9
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.9
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.9
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.9
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.9
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.89
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.89
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.89
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.89
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.89
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.89
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.89
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.89
3bhy_A 283 Death-associated protein kinase 3; death associate 99.89
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.89
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.89
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.89
3niz_A 311 Rhodanese family protein; structural genomics, str 99.89
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.89
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.89
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.89
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.89
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.89
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.89
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.89
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.89
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.89
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.89
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.89
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.89
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.89
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.89
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.89
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.89
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.89
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.89
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.89
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.88
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.88
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.88
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.88
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.88
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.88
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.88
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.88
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.88
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.88
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.88
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.88
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.88
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.88
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.88
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.88
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.88
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.88
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.88
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.88
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.88
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.88
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.88
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.88
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.88
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.88
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.88
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.88
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.88
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.88
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.88
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.88
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.88
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.88
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.88
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.88
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.88
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.88
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.88
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.88
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.88
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.88
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.88
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.87
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.87
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.87
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.87
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.87
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.87
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.87
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.87
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.87
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.87
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.87
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.87
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.87
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.87
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.87
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.87
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.87
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.87
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.87
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.87
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.87
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.87
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.87
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.87
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.86
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.86
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.86
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.86
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.86
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.86
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.86
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.86
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.86
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.86
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.86
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.86
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.86
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.86
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.86
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.86
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.86
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.86
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.86
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.86
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.86
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.86
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.86
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.86
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.86
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.86
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.86
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.86
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.86
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.86
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.86
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.86
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.86
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.85
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.85
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.85
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.85
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.85
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.85
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.85
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.85
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.85
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.85
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.85
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.85
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.85
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.85
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.85
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.85
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.85
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.84
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.84
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.84
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.84
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.84
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.84
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.84
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.84
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.84
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.84
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.84
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.84
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.84
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.84
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.84
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.84
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.84
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.84
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.83
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.83
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.83
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.83
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.83
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.82
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.82
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.82
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.82
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.82
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.82
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.81
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.81
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.8
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.8
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.77
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.72
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.65
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.64
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.53
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 99.2
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 98.94
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 98.74
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 97.98
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 97.92
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.82
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 97.77
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 97.3
3ats_A 357 Putative uncharacterized protein; hypothetical pro 96.97
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 96.14
3dxq_A 301 Choline/ethanolamine kinase family protein; NP_106 94.59
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 93.45
2q83_A346 YTAA protein; 2635576, structural genomics, joint 92.11
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 91.72
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 90.36
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 85.7
3c5i_A 369 Choline kinase; choline, kinase, malaria, transfer 81.98
2ppq_A 322 HSK, HK, homoserine kinase; structural genomics, M 81.86
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
Probab=99.97  E-value=2e-31  Score=173.62  Aligned_cols=104  Identities=20%  Similarity=0.200  Sum_probs=96.4

Q ss_pred             CCcEEEEEEeccccc-hhHHHHHhhhCCCCCcceEEEEEEcCCEEEEEecCC-CCCHHHHHHhCCCCCHHHHHHHHHHHH
Q psy14425          2 AGIVVVLEIMSREAS-GNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPC-SGDLHSYVRQRKRLKEAEARKLFRQIA   79 (114)
Q Consensus         2 t~~~~avK~~~~~~~-~~e~~~~~~~~~h~~i~~~~~~~~~~~~~~~v~e~~-~~~l~~~~~~~~~~~~~~~~~~~~~~~   79 (114)
                      ||+.||||.++.+.. .+|+.++.++ +||||++++++|.+++.+|+||||+ +|+|.+++...+.+++..+..++.|++
T Consensus        82 ~g~~vAiK~i~~~~~~~~E~~il~~l-~HpnIV~l~~~~~~~~~~~ivmEy~~gg~L~~~l~~~~~l~e~~~~~~~~qi~  160 (336)
T 4g3f_A           82 TGFQCAVKKVRLEVFRVEELVACAGL-SSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQAL  160 (336)
T ss_dssp             TCCEEEEEEEETTTCCTHHHHTTTTC-CCTTBCCEEEEEEETTEEEEEECCCTTCBHHHHHHHHSSCCHHHHHHHHHHHH
T ss_pred             CCCEEEEEEECHHHhHHHHHHHHHhC-CCCCCCcEEEEEEECCEEEEEEeccCCCcHHHHHHHcCCCCHHHHHHHHHHHH
Confidence            789999999987654 4688888888 9999999999999999999999999 899999998888899999999999999


Q ss_pred             HHHHHHHHCCCccCCCCCCcEEEecCC
Q psy14425         80 ETVRACHAQGIVLRDLKLRKFVFCNAQ  106 (114)
Q Consensus        80 ~~l~~lh~~~i~h~~lk~~nil~~~~~  106 (114)
                      .|+.|+|+++|+||||||+|||++.++
T Consensus       161 ~aL~ylH~~~IiHRDlKp~NILl~~~g  187 (336)
T 4g3f_A          161 EGLEYLHTRRILHGDVKADNVLLSSDG  187 (336)
T ss_dssp             HHHHHHHTTTEECSCCCGGGEEECTTS
T ss_pred             HHHHHHHHCCceecccCHHHEEEeCCC
Confidence            999999999999999999999998765



>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-14
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 4e-14
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-13
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 7e-13
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-12
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-12
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-12
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-12
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-12
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 7e-12
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 7e-12
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-11
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-11
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 9e-11
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-10
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-10
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-10
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-10
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 7e-10
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-10
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 8e-10
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-09
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-09
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-09
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-09
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-09
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-09
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 3e-09
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-09
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 4e-09
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 5e-09
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-09
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 6e-09
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-08
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-08
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-08
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-08
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-08
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 6e-08
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 6e-08
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-08
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-07
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-07
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-07
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-07
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-07
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-07
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-07
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 6e-07
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 9e-07
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-06
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-06
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-06
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-06
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 9e-06
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-05
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-05
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-04
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-04
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-04
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 1e-04
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: gamma-subunit of glycogen phosphorylase kinase (Phk)
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score = 64.3 bits (156), Expect = 3e-14
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 13  REASGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPCS-GDLHSYVRQRKRLKEAEA 71
           REA+   +    ++  HP+I  L +    +   +LVF     G+L  Y+ ++  L E E 
Sbjct: 53  REATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKKGELFDYLTEKVTLSEKET 112

Query: 72  RKLFRQIAETVRACHAQGIVLRDLKLRKFVFCN 104
           RK+ R + E + A H   IV RDLK    +  +
Sbjct: 113 RKIMRALLEVICALHKLNIVHRDLKPENILLDD 145


>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.96
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.96
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.96
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.96
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.96
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.96
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.96
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.96
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.96
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.96
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.95
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.95
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.95
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.95
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.95
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.95
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.95
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.95
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.95
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.94
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.94
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.94
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.94
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.94
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.94
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.94
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.93
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.93
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.93
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.93
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.93
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.93
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.92
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.92
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.92
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.92
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.92
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.92
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.92
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.92
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.92
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.92
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.92
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.91
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.91
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.91
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.91
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.9
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.9
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.9
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.9
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.9
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.9
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.89
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.89
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.89
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.89
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.88
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.73
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.71
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 97.83
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 96.83
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 96.32
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 89.86
d2ppqa1 316 Homoserine kinase ThrB {Agrobacterium tumefaciens 87.18
d1zyla1 325 RdoA {Escherichia coli [TaxId: 562]} 81.87
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=6.6e-30  Score=161.10  Aligned_cols=108  Identities=19%  Similarity=0.324  Sum_probs=95.4

Q ss_pred             CCcEEEEEEecccc-------chhHHHHHhhhCCCCCcceEEEEEEcCCEEEEEecCC-CCCHHHHHHhCCCCCHHHHHH
Q psy14425          2 AGIVVVLEIMSREA-------SGNLLSAHYRLDSHPHINSLHEVLLGDKLAYLVFPPC-SGDLHSYVRQRKRLKEAEARK   73 (114)
Q Consensus         2 t~~~~avK~~~~~~-------~~~e~~~~~~~~~h~~i~~~~~~~~~~~~~~~v~e~~-~~~l~~~~~~~~~~~~~~~~~   73 (114)
                      ||+.||+|.++...       ..+|+.++.++ +||||+++++++.+++.++++|||+ +|+|.+++...+.+++..+..
T Consensus        29 ~~~~vAiK~i~~~~~~~~~~~~~~Ei~~l~~l-~HpnIv~~~~~~~~~~~~~ivmEy~~gg~L~~~l~~~~~l~e~~~~~  107 (271)
T d1nvra_          29 TEEAVAVKIVDMKRAVDCPENIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQR  107 (271)
T ss_dssp             TCCEEEEEEEECC-------CHHHHHHHHHTC-CCTTBCCEEEEEEETTEEEEEEECCTTEEGGGGSBTTTBCCHHHHHH
T ss_pred             CCCEEEEEEEehhhcchHHHHHHHHHHHHHhC-CCCCEeeEeeeeccCceeEEEEeccCCCcHHHHHhcCCCCCHHHHHH
Confidence            68999999986442       23578888877 9999999999999999999999999 889999998777899999999


Q ss_pred             HHHHHHHHHHHHHHCCCccCCCCCCcEEEecCC-cccc
Q psy14425         74 LFRQIAETVRACHAQGIVLRDLKLRKFVFCNAQ-RSVG  110 (114)
Q Consensus        74 ~~~~~~~~l~~lh~~~i~h~~lk~~nil~~~~~-~~~~  110 (114)
                      ++.|++.|+.|||++|++||||||+|||++.++ .+++
T Consensus       108 i~~qi~~al~ylH~~~IiHrDiKp~NILl~~~~~~KL~  145 (271)
T d1nvra_         108 FFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKIS  145 (271)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEEECTTCCEEEC
T ss_pred             HHHHHHHHHHHHHHcCCccCcccHHHEEECCCCCEEEc
Confidence            999999999999999999999999999997654 3443



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure