Diaphorina citri psyllid: psy1442


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MTYMEFLGCTMTAFGPVIAMFLTTIMQDPVKKSRGGLQYVSDRNTMDNTYAMAYVSGLGYGTISAAFSLLNVLDQVSGPGTMGLKGESQYFGFTTSIFTCCFSLLHVFWSIVFFRGVEIKNRTLVASVVLSHIFISSYTWYMNSSGLFSVLFIIVFTLFTAMFAYKVIGGSKKTMCNGENLIAEAN
cccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEccccccEEEEEHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
*TYMEFLGCTMTAFGPVIAMFLTTIMQDPVKKSRGGLQYVSDRNTMDNTYAMAYVSGLGYGTISAAFSLLNVLDQVSGPGTMGLKGESQYFGFTTSIFTCCFSLLHVFWSIVFFRGVEIKNRTLVASVVLSHIFISSYTWYMNSSGLFSVLFIIVFTLFTAMFAYKVIGGSKKTMCNGENLI****
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYMEFLGCTMTAFGPVIAMFLTTIMQDPVKKSRGGLQYVSDRNTMDNTYAMAYVSGLGYGTISAAFSLLNVLDQVSGPGTMGLKGESQYFGFTTSIFTCCFSLLHVFWSIVFFRGVEIKNRTLVASVVLSHIFISSYTWYMNSSGLFSVLFIIVFTLFTAMFAYKVIGGSKKTMCNGENLIAEAN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gamma-secretase subunit Aph-1 Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch. It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.confidentQ9VQG2
Gamma-secretase subunit APH-1A Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.confidentQ96BI3
Gamma-secretase subunit APH-1A Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.confidentQ8BVF7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0008233 [MF]peptidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0006509 [BP]membrane protein ectodomain proteolysisprobableGO:0044238, GO:0019538, GO:0033619, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0006508
GO:0016485 [BP]protein processingprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030133 [CC]transport vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted