Diaphorina citri psyllid: psy14432


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MNTILSFHKLISNQRNVVKRFYKSSISLDKLYPNSSMLLKTPTPDQVKAPDGLKFNGVIPVKAPDGLKFNGVIPVVIPRFSYITEELDITYSRSSGPGGQHVNSVSTKVDIRFKVNAANWLNEDVKKQLIELNKNRLNKDGYLIIKSDRTRSQQLNLADAMTTLRNMIWKAAKPAPQISEDTIDRIRIR
cccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccEEEEEEEccccccccHHHHHHHHHHHccccccccEEEEECcccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcc
***ILSFHKLISNQRNVVKRFYKSSISLDKLYPNSSML*****************NGVI****PD*LKFNGVIPVVIPRFSYITEELDITYSR***P**QHVNSVSTKVDIRFKVNAANWLNEDVKKQLIELNKNRLNKDGYLIIKSDRTRSQQLNLADAMTTLRNMIWKA******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTILSFHKLISNQRNVVKRFYKSSISLDKLYPNSSMLLKTPTPDQVKAPDGLKFNGVIPVKAPDGLKFNGVIPVVIPRFSYITEELDITYSRSSGPGGQHVNSVSTKVDIRFKVNAANWLNEDVKKQLIELNKNRLNKDGYLIIKSDRTRSQQLNLADAMTTLRNMIWKAAKPAPQISEDTIDRIRIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-tRNA hydrolase ICT1, mitochondrial Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.confidentD2HD32
Peptidyl-tRNA hydrolase ICT1, mitochondrial Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.confidentQ3T116
Peptidyl-tRNA hydrolase ICT1, mitochondrial Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.confidentQ8R035

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DH9, chain Y
Confidence level:very confident
Coverage over the Query: 75-176
View the alignment between query and template
View the model in PyMOL
Template: 1GQE, chain A
Confidence level:very confident
Coverage over the Query: 22-118,143-172
View the alignment between query and template
View the model in PyMOL