Diaphorina citri psyllid: psy14437


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MHKLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPRPKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPREKTDPS
cccccEEccccEEcEEEcEEccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccc
**KLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKC****************************APCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKC**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPRPKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPREKTDPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rho-associated protein kinase 1 Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, PFN1 and PPP1R12A. Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing. Required for centrosome positioning and centrosome-dependent exit from mitosis. Plays a role in terminal erythroid differentiation. Promotes keratinocyte terminal differentiation (By similarity). Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress. Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles.confidentP70335
Rho-associated protein kinase 1 Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, PFN1 and PPP1R12A. Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing. Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress. Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Required for centrosome positioning and centrosome-dependent exit from mitosis Plays a role in terminal erythroid differentiation. May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles. Promotes keratinocyte terminal differentiation.confidentO77819

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030855 [BP]epithelial cell differentiationprobableGO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0009888, GO:0044763, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0042325 [BP]regulation of phosphorylationprobableGO:0019220, GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0050901 [BP]leukocyte tethering or rollingprobableGO:0040011, GO:0022610, GO:0016337, GO:0048870, GO:0045123, GO:0009987, GO:0006928, GO:0002376, GO:0050900, GO:0051674, GO:0007159, GO:0008150, GO:0007155, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0016525 [BP]negative regulation of angiogenesisprobableGO:0051093, GO:0022603, GO:0050793, GO:0045765, GO:0008150, GO:1901342, GO:0065007, GO:2000026, GO:0051239, GO:0048519, GO:0050789
GO:0030030 [BP]cell projection organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0051020 [MF]GTPase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0045616 [BP]regulation of keratinocyte differentiationprobableGO:0050793, GO:2000026, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0030856, GO:0051239, GO:0045604, GO:0045682, GO:0050789
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0032970 [BP]regulation of actin filament-based processprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007266 [BP]Rho protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699
GO:0022614 [BP]membrane to membrane dockingprobableGO:0022406, GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:2000040 [BP]regulation of planar cell polarity pathway involved in axis elongationprobableGO:0048638, GO:2000095, GO:2000050, GO:0050793, GO:0040008, GO:0022603, GO:0048583, GO:0050794, GO:0009966, GO:0030111, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ROW, chain A
Confidence level:confident
Coverage over the Query: 10-40
View the alignment between query and template
View the model in PyMOL
Template: 3TFM, chain A
Confidence level:probable
Coverage over the Query: 43-132
View the alignment between query and template
View the model in PyMOL