Psyllid ID: psy14437


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MHKLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPRPKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPREKTDPS
cccccEEccccEEcEEEcEEccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccc
cccEEEEEEEEEEcEEEEEEcHHHccccHccccccEEcccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEcccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccc
MHKLSVLnfnvtpircrikvhkdhlngkeeaiapcklhcdpnsakemlllapstddqKLWVQRLSKKIQKcgykantlsdgvkisprpkdhlngkeeaiapcklhcdpnsakemlllapstddqKLWVQRLSKKIQKcgykantlsdgvkisprektdps
mhklsvlnfnvtpircrIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKiqkcgykantlsdgvkisprpKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKiqkcgykantlsdgvkisprektdps
MHKLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPRPKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPREKTDPS
****SVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTL*********************APCKLHC*******MLLLAPSTDDQKLWVQRLSKKIQKCGYKAN*****************
**KLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKK**********************************CKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKI*************************
MHKLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPRPKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKI*********
**KLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKC*************************EAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKC**********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKLSVLNFNVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPRPKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLSDGVKISPREKTDPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query160 2.2.26 [Sep-21-2011]
Q280211388 Rho-associated protein ki yes N/A 0.312 0.036 0.62 1e-11
Q628681388 Rho-associated protein ki yes N/A 0.312 0.036 0.62 1e-11
O778191354 Rho-associated protein ki yes N/A 0.425 0.050 0.520 1e-11
P703351354 Rho-associated protein ki yes N/A 0.425 0.050 0.520 1e-11
P703361388 Rho-associated protein ki no N/A 0.312 0.036 0.62 1e-11
O751161388 Rho-associated protein ki yes N/A 0.312 0.036 0.6 3e-11
Q134641354 Rho-associated protein ki no N/A 0.425 0.050 0.520 4e-11
P615841003 Rho-associated protein ki no N/A 0.425 0.067 0.520 5e-11
Q636441369 Rho-associated protein ki no N/A 0.406 0.047 0.473 5e-10
>sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%)

Query: 15   RCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRL 64
            RC IK HKDH++ KEE IAPCK++ D +SAK +LLLA ST++Q+ WV RL
Sbjct: 1295 RCHIKCHKDHMDKKEEIIAPCKVYYDISSAKNLLLLANSTEEQQKWVSRL 1344




Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus.
Bos taurus (taxid: 9913)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 Back     alignment and function description
>sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 Back     alignment and function description
>sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 Back     alignment and function description
>sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 Back     alignment and function description
>sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 Back     alignment and function description
>sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 Back     alignment and function description
>sp|P61584|ROCK1_PANTR Rho-associated protein kinase 1 (Fragment) OS=Pan troglodytes GN=ROCK1 PE=3 SV=1 Back     alignment and function description
>sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
328705451 1366 PREDICTED: rho-associated protein kinase 0.45 0.052 0.833 8e-28
242021161 1368 Rho-associated protein kinase, putative 0.456 0.053 0.753 1e-25
332025901 1371 Rho-associated protein kinase 2 [Acromyr 0.456 0.053 0.68 6e-24
307212717 1370 Rho-associated protein kinase 2 [Harpegn 0.456 0.053 0.68 7e-24
328792632 1370 PREDICTED: rho-associated protein kinase 0.456 0.053 0.68 8e-24
340708620 1342 PREDICTED: rho-associated protein kinase 0.456 0.054 0.68 8e-24
380023438 1370 PREDICTED: rho-associated protein kinase 0.456 0.053 0.68 8e-24
350413242 1370 PREDICTED: rho-associated protein kinase 0.456 0.053 0.68 8e-24
307183656 1370 Rho-associated protein kinase 2 [Campono 0.456 0.053 0.666 1e-23
345482974 1370 PREDICTED: rho-associated protein kinase 0.456 0.053 0.693 1e-23
>gi|328705451|ref|XP_001945269.2| PREDICTED: rho-associated protein kinase 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 64/72 (88%)

Query: 16   CRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKA 75
            CRIKVHK+HL  KE+AIAPCKLH DP SAKE+L+LAPS DDQKLWVQRLSKKIQKCGYKA
Sbjct: 1267 CRIKVHKEHLERKEDAIAPCKLHNDPTSAKELLILAPSRDDQKLWVQRLSKKIQKCGYKA 1326

Query: 76   NTLSDGVKISPR 87
            NT  DG KISPR
Sbjct: 1327 NTNLDGSKISPR 1338




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242021161|ref|XP_002431014.1| Rho-associated protein kinase, putative [Pediculus humanus corporis] gi|212516243|gb|EEB18276.1| Rho-associated protein kinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332025901|gb|EGI66057.1| Rho-associated protein kinase 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307212717|gb|EFN88393.1| Rho-associated protein kinase 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328792632|ref|XP_003251752.1| PREDICTED: rho-associated protein kinase 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340708620|ref|XP_003392920.1| PREDICTED: rho-associated protein kinase 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380023438|ref|XP_003695530.1| PREDICTED: rho-associated protein kinase 2 [Apis florea] Back     alignment and taxonomy information
>gi|350413242|ref|XP_003489930.1| PREDICTED: rho-associated protein kinase 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307183656|gb|EFN70359.1| Rho-associated protein kinase 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345482974|ref|XP_001603493.2| PREDICTED: rho-associated protein kinase 2-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
FB|FBgn00261811390 rok "Rho-kinase" [Drosophila m 0.525 0.060 0.516 7.2e-17
UNIPROTKB|F1PE531306 ROCK2 "Uncharacterized protein 0.35 0.042 0.625 1e-13
ZFIN|ZDB-GENE-060125-21401 rock2b "rho-associated, coiled 0.45 0.051 0.486 1.5e-13
UNIPROTKB|J3KRH699 ROCK1 "Rho-associated protein 0.425 0.686 0.520 2.1e-13
UNIPROTKB|F1N3191341 ROCK2 "Rho-associated protein 0.35 0.041 0.625 7.7e-13
UNIPROTKB|F1SCR11348 ROCK2 "Uncharacterized protein 0.35 0.041 0.625 7.7e-13
UNIPROTKB|Q280211388 ROCK2 "Rho-associated protein 0.35 0.040 0.625 8e-13
MGI|MGI:1079261388 Rock2 "Rho-associated coiled-c 0.35 0.040 0.625 8e-13
RGD|35901388 Rock2 "Rho-associated coiled-c 0.35 0.040 0.625 8e-13
UNIPROTKB|Q628681388 Rock2 "Rho-associated protein 0.35 0.040 0.625 8e-13
FB|FBgn0026181 rok "Rho-kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 7.2e-17, P = 7.2e-17
 Identities = 46/89 (51%), Positives = 61/89 (68%)

Query:    15 RCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYK 74
             RCR K+HK+H++ K + +APCKL+ DP SA++MLLLA + +DQ LWV RL K+IQK GYK
Sbjct:  1288 RCRNKIHKEHVD-KHDPLAPCKLNHDPRSARDMLLLAATPEDQSLWVARLLKRIQKSGYK 1346

Query:    75 A----NTLSDGVKISPRPKDHLNGKEEAI 99
             A    N  +DG KISP      + K  A+
Sbjct:  1347 AASYNNNSTDGSKISPSQSTRSSYKPYAV 1375


GO:0004674 "protein serine/threonine kinase activity" evidence=ISS;NAS;IDA
GO:0019992 "diacylglycerol binding" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=ISS;NAS
GO:0005515 "protein binding" evidence=IPI
GO:0007266 "Rho protein signal transduction" evidence=IPI
GO:0042067 "establishment of ommatidial planar polarity" evidence=IMP
GO:0035317 "imaginal disc-derived wing hair organization" evidence=IGI;IMP
GO:0032231 "regulation of actin filament bundle assembly" evidence=IGI;IMP
GO:0051020 "GTPase binding" evidence=IPI
GO:0001932 "regulation of protein phosphorylation" evidence=IMP
GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP
GO:0007391 "dorsal closure" evidence=TAS
GO:0016318 "ommatidial rotation" evidence=NAS
GO:0032065 "cortical protein anchoring" evidence=IMP
GO:0035191 "nuclear axial expansion" evidence=IMP
GO:0001736 "establishment of planar polarity" evidence=TAS
GO:0005543 "phospholipid binding" evidence=IEA
GO:0017048 "Rho GTPase binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0000910 "cytokinesis" evidence=IDA;IMP
GO:0050770 "regulation of axonogenesis" evidence=IGI
GO:0000092 "mitotic anaphase B" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
GO:0000022 "mitotic spindle elongation" evidence=IMP
GO:0016331 "morphogenesis of embryonic epithelium" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0045184 "establishment of protein localization" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0008335 "female germline ring canal stabilization" evidence=IMP
GO:0007309 "oocyte axis specification" evidence=IMP
GO:0007300 "ovarian nurse cell to oocyte transport" evidence=IMP
GO:0048599 "oocyte development" evidence=IMP
GO:0007302 "nurse cell nucleus anchoring" evidence=IMP
GO:0042325 "regulation of phosphorylation" evidence=IDA
GO:0008544 "epidermis development" evidence=IMP
GO:0032956 "regulation of actin cytoskeleton organization" evidence=IMP
GO:2000040 "regulation of planar cell polarity pathway involved in axis elongation" evidence=IDA
UNIPROTKB|F1PE53 ROCK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060125-2 rock2b "rho-associated, coiled-coil containing protein kinase 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J3KRH6 ROCK1 "Rho-associated protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N319 ROCK2 "Rho-associated protein kinase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCR1 ROCK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q28021 ROCK2 "Rho-associated protein kinase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:107926 Rock2 "Rho-associated coiled-coil containing protein kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3590 Rock2 "Rho-associated coiled-coil containing protein kinase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62868 Rock2 "Rho-associated protein kinase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P70335ROCK1_MOUSE2, ., 7, ., 1, 1, ., 10.52050.4250.0502yesN/A
O77819ROCK1_RABIT2, ., 7, ., 1, 1, ., 10.52050.4250.0502yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
KOG0612|consensus1317 99.49
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.29
KOG0612|consensus1317 98.23
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.18
>KOG0612|consensus Back     alignment and domain information
Probab=99.49  E-value=5.5e-15  Score=145.78  Aligned_cols=65  Identities=52%  Similarity=0.759  Sum_probs=62.4

Q ss_pred             cccCccccccccccccccccccccCcccccCchhhhhHhhcCCChHHHHHHHHHHHHhHhhcCCCCCCCC
Q psy14437         10 NVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLS   79 (160)
Q Consensus        10 a~ecrrC~~K~Hkdh~d~ke~~i~pCk~n~D~~~AkeLLLla~s~eeq~~WVs~L~k~I~k~~~~~~s~~   79 (160)
                      ||||++||+|||+||+|+   ++.||+  ||+.+|++|||+|.+++||..||++|.++|++.++.+++.+
T Consensus      1236 ~ye~~~~~~~~~~d~~~k---~m~p~k--y~~~~a~~l~l~a~~~~dq~eWV~~l~k~~~k~~~~~~~~~ 1300 (1317)
T KOG0612|consen 1236 AYECRRCHIKCHKDHMDK---IMAPCK--YDTSSARHLLLLAESTEDQAKWVQRLVKKIPKPLPAAGSFS 1300 (1317)
T ss_pred             HHHHHHhhcccccccccc---ccCccc--ccccCCccceeccCCchHHHHHHHHHhcccCCCCCccccee
Confidence            999999999999999997   899999  99999999999999999999999999999999998877764



>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
2row_A84 The C1 Domain Of Rock Ii Length = 84 7e-04
>pdb|2ROW|A Chain A, The C1 Domain Of Rock Ii Length = 84 Back     alignment and structure

Iteration: 1

Score = 39.7 bits (91), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 17/26 (65%), Positives = 21/26 (80%) Query: 15 RCRIKVHKDHLNGKEEAIAPCKLHCD 40 RC IK HKDH++ KEE IAPCK++ D Sbjct: 59 RCHIKCHKDHMDKKEEIIAPCKVYYD 84

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 98.27
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 97.28
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 97.24
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 94.09
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 91.34
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 90.62
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 87.56
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 85.59
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 85.53
2d9v_A130 Pleckstrin homology domain-containing protein fami 85.2
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 85.08
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 84.95
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 84.78
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 84.0
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 83.98
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 83.41
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 82.81
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 82.79
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 82.58
3rcp_A103 Pleckstrin homology domain-containing family A ME; 81.11
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 80.81
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 80.75
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 80.43
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 80.4
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 80.4
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 80.02
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
Probab=98.27  E-value=8e-08  Score=69.20  Aligned_cols=31  Identities=55%  Similarity=0.922  Sum_probs=30.2

Q ss_pred             cccCccccccccccccccccccccCcccccC
Q psy14437         10 NVTPIRCRIKVHKDHLNGKEEAIAPCKLHCD   40 (160)
Q Consensus        10 a~ecrrC~~K~Hkdh~d~ke~~i~pCk~n~D   40 (160)
                      +|+|+.|.+.|||.+.+++|.++.+|++|||
T Consensus        54 G~~C~~C~~~~HkrC~~k~~~v~~~C~~~~d   84 (84)
T 2row_A           54 ALECRRCHIKCHKDHMDKKEEIIAPCKVYYD   84 (84)
T ss_dssp             EEEESSSCCEEEHHHHHHTCTTCCCCSTTTC
T ss_pred             CCEecCCCCccchhHhCCccccccccCcCCC
Confidence            9999999999999999998899999999999



>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 91.13
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 90.6
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 90.3
d1wi1a_126 Calcium-dependent activator protein for secretion, 89.9
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 85.53
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 84.85
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 84.76
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 84.23
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 84.09
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 83.79
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 82.97
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 82.53
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 82.28
d1wi1a_126 Calcium-dependent activator protein for secretion, 82.27
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 81.09
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 80.65
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain)
domain: Kinase suppressor of Ras, Ksr
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=91.13  E-value=0.028  Score=34.66  Aligned_cols=25  Identities=28%  Similarity=0.592  Sum_probs=21.6

Q ss_pred             cccccCccccccccccccccccccccCcc
Q psy14437          8 NFNVTPIRCRIKVHKDHLNGKEEAIAPCK   36 (160)
Q Consensus         8 ~~a~ecrrC~~K~Hkdh~d~ke~~i~pCk   36 (160)
                      --+|.|+.|.+.+||.-.++    ++|||
T Consensus        25 ~qg~~C~~C~~~~Hk~C~~~----~P~C~   49 (49)
T d1kbea_          25 IFGVKCKHCRLKCHNKCTKE----APACR   49 (49)
T ss_dssp             CCEEEETTTTEEESSSCTTT----SCCCC
T ss_pred             hCcCCcCCCCChHhHhhccc----CCCCC
Confidence            35899999999999999874    78996



>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure