Psyllid ID: psy14437
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| 328705451 | 1366 | PREDICTED: rho-associated protein kinase | 0.45 | 0.052 | 0.833 | 8e-28 | |
| 242021161 | 1368 | Rho-associated protein kinase, putative | 0.456 | 0.053 | 0.753 | 1e-25 | |
| 332025901 | 1371 | Rho-associated protein kinase 2 [Acromyr | 0.456 | 0.053 | 0.68 | 6e-24 | |
| 307212717 | 1370 | Rho-associated protein kinase 2 [Harpegn | 0.456 | 0.053 | 0.68 | 7e-24 | |
| 328792632 | 1370 | PREDICTED: rho-associated protein kinase | 0.456 | 0.053 | 0.68 | 8e-24 | |
| 340708620 | 1342 | PREDICTED: rho-associated protein kinase | 0.456 | 0.054 | 0.68 | 8e-24 | |
| 380023438 | 1370 | PREDICTED: rho-associated protein kinase | 0.456 | 0.053 | 0.68 | 8e-24 | |
| 350413242 | 1370 | PREDICTED: rho-associated protein kinase | 0.456 | 0.053 | 0.68 | 8e-24 | |
| 307183656 | 1370 | Rho-associated protein kinase 2 [Campono | 0.456 | 0.053 | 0.666 | 1e-23 | |
| 345482974 | 1370 | PREDICTED: rho-associated protein kinase | 0.456 | 0.053 | 0.693 | 1e-23 |
| >gi|328705451|ref|XP_001945269.2| PREDICTED: rho-associated protein kinase 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 128 bits (321), Expect = 8e-28, Method: Compositional matrix adjust.
Identities = 60/72 (83%), Positives = 64/72 (88%)
Query: 16 CRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKA 75
CRIKVHK+HL KE+AIAPCKLH DP SAKE+L+LAPS DDQKLWVQRLSKKIQKCGYKA
Sbjct: 1267 CRIKVHKEHLERKEDAIAPCKLHNDPTSAKELLILAPSRDDQKLWVQRLSKKIQKCGYKA 1326
Query: 76 NTLSDGVKISPR 87
NT DG KISPR
Sbjct: 1327 NTNLDGSKISPR 1338
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242021161|ref|XP_002431014.1| Rho-associated protein kinase, putative [Pediculus humanus corporis] gi|212516243|gb|EEB18276.1| Rho-associated protein kinase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332025901|gb|EGI66057.1| Rho-associated protein kinase 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307212717|gb|EFN88393.1| Rho-associated protein kinase 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328792632|ref|XP_003251752.1| PREDICTED: rho-associated protein kinase 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340708620|ref|XP_003392920.1| PREDICTED: rho-associated protein kinase 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380023438|ref|XP_003695530.1| PREDICTED: rho-associated protein kinase 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350413242|ref|XP_003489930.1| PREDICTED: rho-associated protein kinase 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307183656|gb|EFN70359.1| Rho-associated protein kinase 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345482974|ref|XP_001603493.2| PREDICTED: rho-associated protein kinase 2-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| FB|FBgn0026181 | 1390 | rok "Rho-kinase" [Drosophila m | 0.525 | 0.060 | 0.516 | 7.2e-17 | |
| UNIPROTKB|F1PE53 | 1306 | ROCK2 "Uncharacterized protein | 0.35 | 0.042 | 0.625 | 1e-13 | |
| ZFIN|ZDB-GENE-060125-2 | 1401 | rock2b "rho-associated, coiled | 0.45 | 0.051 | 0.486 | 1.5e-13 | |
| UNIPROTKB|J3KRH6 | 99 | ROCK1 "Rho-associated protein | 0.425 | 0.686 | 0.520 | 2.1e-13 | |
| UNIPROTKB|F1N319 | 1341 | ROCK2 "Rho-associated protein | 0.35 | 0.041 | 0.625 | 7.7e-13 | |
| UNIPROTKB|F1SCR1 | 1348 | ROCK2 "Uncharacterized protein | 0.35 | 0.041 | 0.625 | 7.7e-13 | |
| UNIPROTKB|Q28021 | 1388 | ROCK2 "Rho-associated protein | 0.35 | 0.040 | 0.625 | 8e-13 | |
| MGI|MGI:107926 | 1388 | Rock2 "Rho-associated coiled-c | 0.35 | 0.040 | 0.625 | 8e-13 | |
| RGD|3590 | 1388 | Rock2 "Rho-associated coiled-c | 0.35 | 0.040 | 0.625 | 8e-13 | |
| UNIPROTKB|Q62868 | 1388 | Rock2 "Rho-associated protein | 0.35 | 0.040 | 0.625 | 8e-13 |
| FB|FBgn0026181 rok "Rho-kinase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 222 (83.2 bits), Expect = 7.2e-17, P = 7.2e-17
Identities = 46/89 (51%), Positives = 61/89 (68%)
Query: 15 RCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYK 74
RCR K+HK+H++ K + +APCKL+ DP SA++MLLLA + +DQ LWV RL K+IQK GYK
Sbjct: 1288 RCRNKIHKEHVD-KHDPLAPCKLNHDPRSARDMLLLAATPEDQSLWVARLLKRIQKSGYK 1346
Query: 75 A----NTLSDGVKISPRPKDHLNGKEEAI 99
A N +DG KISP + K A+
Sbjct: 1347 AASYNNNSTDGSKISPSQSTRSSYKPYAV 1375
|
|
| UNIPROTKB|F1PE53 ROCK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060125-2 rock2b "rho-associated, coiled-coil containing protein kinase 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KRH6 ROCK1 "Rho-associated protein kinase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N319 ROCK2 "Rho-associated protein kinase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SCR1 ROCK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28021 ROCK2 "Rho-associated protein kinase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107926 Rock2 "Rho-associated coiled-coil containing protein kinase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|3590 Rock2 "Rho-associated coiled-coil containing protein kinase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q62868 Rock2 "Rho-associated protein kinase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| KOG0612|consensus | 1317 | 99.49 | ||
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.29 | |
| KOG0612|consensus | 1317 | 98.23 | ||
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.18 |
| >KOG0612|consensus | Back alignment and domain information |
|---|
Probab=99.49 E-value=5.5e-15 Score=145.78 Aligned_cols=65 Identities=52% Similarity=0.759 Sum_probs=62.4
Q ss_pred cccCccccccccccccccccccccCcccccCchhhhhHhhcCCChHHHHHHHHHHHHhHhhcCCCCCCCC
Q psy14437 10 NVTPIRCRIKVHKDHLNGKEEAIAPCKLHCDPNSAKEMLLLAPSTDDQKLWVQRLSKKIQKCGYKANTLS 79 (160)
Q Consensus 10 a~ecrrC~~K~Hkdh~d~ke~~i~pCk~n~D~~~AkeLLLla~s~eeq~~WVs~L~k~I~k~~~~~~s~~ 79 (160)
||||++||+|||+||+|+ ++.||+ ||+.+|++|||+|.+++||..||++|.++|++.++.+++.+
T Consensus 1236 ~ye~~~~~~~~~~d~~~k---~m~p~k--y~~~~a~~l~l~a~~~~dq~eWV~~l~k~~~k~~~~~~~~~ 1300 (1317)
T KOG0612|consen 1236 AYECRRCHIKCHKDHMDK---IMAPCK--YDTSSARHLLLLAESTEDQAKWVQRLVKKIPKPLPAAGSFS 1300 (1317)
T ss_pred HHHHHHhhcccccccccc---ccCccc--ccccCCccceeccCCchHHHHHHHHHhcccCCCCCccccee
Confidence 999999999999999997 899999 99999999999999999999999999999999998877764
|
|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 160 | ||||
| 2row_A | 84 | The C1 Domain Of Rock Ii Length = 84 | 7e-04 |
| >pdb|2ROW|A Chain A, The C1 Domain Of Rock Ii Length = 84 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| 2row_A | 84 | RHO-associated protein kinase 2; ATP-binding, coil | 98.27 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 97.28 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 97.24 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 94.09 | |
| 2enz_A | 65 | NPKC-theta, protein kinase C theta type; zinc bind | 91.34 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 90.62 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 87.56 | |
| 2eli_A | 85 | Protein kinase C alpha type; PKC-alpha, PKC-A, str | 85.59 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 85.53 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 85.2 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 85.08 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 84.95 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 84.78 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 84.0 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 83.98 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 83.41 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 82.81 | |
| 2yuu_A | 83 | NPKC-delta, protein kinase C delta type; metal bin | 82.79 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 82.58 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 81.11 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 80.81 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 80.75 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 80.43 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 80.4 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 80.4 | |
| 2enn_A | 77 | NPKC-theta, protein kinase C theta type; zinc bind | 80.02 |
| >2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=98.27 E-value=8e-08 Score=69.20 Aligned_cols=31 Identities=55% Similarity=0.922 Sum_probs=30.2
Q ss_pred cccCccccccccccccccccccccCcccccC
Q psy14437 10 NVTPIRCRIKVHKDHLNGKEEAIAPCKLHCD 40 (160)
Q Consensus 10 a~ecrrC~~K~Hkdh~d~ke~~i~pCk~n~D 40 (160)
+|+|+.|.+.|||.+.+++|.++.+|++|||
T Consensus 54 G~~C~~C~~~~HkrC~~k~~~v~~~C~~~~d 84 (84)
T 2row_A 54 ALECRRCHIKCHKDHMDKKEEIIAPCKVYYD 84 (84)
T ss_dssp EEEESSSCCEEEHHHHHHTCTTCCCCSTTTC
T ss_pred CCEecCCCCccchhHhCCccccccccCcCCC
Confidence 9999999999999999998899999999999
|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| d1kbea_ | 49 | Kinase suppressor of Ras, Ksr {Mouse (Mus musculus | 91.13 | |
| d1tbna_ | 66 | Protein kinase c-gamma {Rat (Rattus rattus) [TaxId | 90.6 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 90.3 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 89.9 | |
| d1xa6a3 | 62 | Beta-chimaerin, middle domain {Human (Homo sapiens | 85.53 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 84.85 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 84.76 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 84.23 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 84.09 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 83.79 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 82.97 | |
| d1faqa_ | 52 | RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | 82.53 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 82.28 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 82.27 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 81.09 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 80.65 |
| >d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Cysteine-rich domain superfamily: Cysteine-rich domain family: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) domain: Kinase suppressor of Ras, Ksr species: Mouse (Mus musculus) [TaxId: 10090]
Probab=91.13 E-value=0.028 Score=34.66 Aligned_cols=25 Identities=28% Similarity=0.592 Sum_probs=21.6
Q ss_pred cccccCccccccccccccccccccccCcc
Q psy14437 8 NFNVTPIRCRIKVHKDHLNGKEEAIAPCK 36 (160)
Q Consensus 8 ~~a~ecrrC~~K~Hkdh~d~ke~~i~pCk 36 (160)
--+|.|+.|.+.+||.-.++ ++|||
T Consensus 25 ~qg~~C~~C~~~~Hk~C~~~----~P~C~ 49 (49)
T d1kbea_ 25 IFGVKCKHCRLKCHNKCTKE----APACR 49 (49)
T ss_dssp CCEEEETTTTEEESSSCTTT----SCCCC
T ss_pred hCcCCcCCCCChHhHhhccc----CCCCC
Confidence 35899999999999999874 78996
|
| >d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|