Diaphorina citri psyllid: psy14439


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MARGSLNSDLHSHLPSINEVGSDRNMKAEPISPNSMVSYSRSNSNGSFQSASNNVGNNSSSSGHEDEESGSPLNYKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCHQTDSSGYKLSKATVLQKSIDYIQFLVQQKKKLEEERNGLRKEVVALRIMQANYDIMVKAQQTPLGQTEARLSDEVKFQVFQSIMDELFSTFCNVGVSNFSELSACVFSWLEEYCKPQTLKQNIASVLSRIANSDSH
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccc
************************************************************************************QAEQKRRDAIKKGYDSLQDLVPTCHQT**SGYKLSKATVLQKSIDYIQFLVQQKKKL***RNGLRKEVVALRIMQANYDIMVKAQ********ARLSDEVKFQVFQSIMDELFSTFCNVGVSNFSELSACVFSWLEEYCKPQTLKQNIASVL**IA*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARGSLNSDLHSHLPSINEVGSDRNMKAEPISPNSMVSYSRSNSNGSFQSASNNVGNNSSSSGHEDEESGSPLNYKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCHQTDSSGYKLSKATVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQANYDIMVKAQQTPLGQTEARLSDEVKFQVFQSIMDELFSTFCNVGVSNFSELSACVFSWLEEYCKPQTLKQNIASVLSRIANSDSH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008343 [BP]adult feeding behaviorprobableGO:0007631, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0035071 [BP]salivary gland cell autophagic cell deathprobableGO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006913 [BP]nucleocytoplasmic transportprobableGO:0051169, GO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NKP, chain B
Confidence level:very confident
Coverage over the Query: 79-159
View the alignment between query and template
View the model in PyMOL