Diaphorina citri psyllid: psy14443

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MESSDIDEERVAIREELKGLTFEQLQKLKEEMGTKLFNKKVFNSKSPSSKFKEHENKNFKRENKNRPREISSKIPQKKFAQQSAPVIPVQKNIPRDPRFDSLCGTFKEKAFHSAYKFIDDIREKEISILKKKLKKEKNPEEKEKVKYLVQRMENQMREAKQRHEKDQQEKEEHTARIQALKHGEKPLFRKKSEKTMLNLVQKFETLKKTGKINKHIEKKTKALKAKERSQHNYFE
cccccHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHccccccccccccHccccHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccc
*******************LTFEQ**********************************************************************RDPRFDSLCGTFKEKAFHSAYKFIDDIREKEISIL*************************************************************KSEKTM***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESSDIDEERVAIREELKGLTFEQLQKLKEEMGTKLFNKKVFNSKSPSSKFKEHENKNFKRENKNRPREISSKIPQKKFAQQSAPVIPVQKNIPRDPRFDSLCGTFKEKAFHSAYKFIDDIREKEISILKKKLKKEKNPEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIQALKHGEKPLFRKKSEKTMLNLVQKFETLKKTGKINKHIEKKTKALKAKERSQHNYFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosomal RNA processing protein 36 homolog Involved in the early processing steps of the pre-rRNA in the maturation pathway leading to the 18S rRNA.confidentQ3UFY0
Ribosomal RNA processing protein 36 homolog Involved in the early processing steps of the pre-rRNA in the maturation pathway leading to the 18S rRNA.confidentA6QNR1
Ribosomal RNA processing protein 36 homolog Involved in the early processing steps of the pre-rRNA in the maturation pathway leading to the 18S rRNA.confidentQ96EU6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0042274 [BP]ribosomal small subunit biogenesisprobableGO:0022613, GO:0044085, GO:0008150, GO:0042254, GO:0071840
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!