Diaphorina citri psyllid: psy14445

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--

MSSIGAGYDLSASQFSPDGRVFQVEYAQKAVENSSTAIGLRGKDGVVIAVEKLVLSKLYDPGANKRIFHVDTHIGLGSGLISAGRQLAETAKTEASEYRSKYGGNIPLHLLNERVSMYVHAYTLYSMVRPFGASLLLASHDKTDGPSLYVVDPSGVSHGYFGCAIGKAKQNAKTEIEKLKLSTLSMEQLAKEAARIIYVVHDELKDKHFELELAWVGEKTNGKFEMVPQSFLEECENYAKASLQDSDSDNDL

ccccccccccccccccccccHHHHHHHHHHHHccccEEEEECccEEEEEEEcccccccccccccccEEEEcccEEEEccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHEEEEEEEEccccccEEEEEccccccccccEEEEccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccEEEEccHHHHHHHHHHHHHHcccccccccc

*****AG*DLSASQFSPDGRVFQVEYAQKAVENSSTAIGLRGKDGVVIAVEKLVLSKLYDPGANKRIFHVDTHIGLGSGLISAGRQLAETAKTEASEYRSKYGGNIPLHLLNERVSMYVHAYTLYSMVRPFGASLLLASHDKTDGPSLYVVDPSGVSHGYFGCAIGKAKQNAKTEIEKLKLSTLSMEQLAKEAARIIYVVHDELKDKHFELELAWVGEKTNGKFEMVPQSFLEECE****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Proteasome subunit alpha type-3	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.	very confident	Q58DU5
Proteasome subunit alpha type-3	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.	very confident	Q27563
Proteasome subunit alpha type-3	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.	very confident	P18422

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022626 [CC]	cytosolic ribosome	confident	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0005839 [CC]	proteasome core complex	confident	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0034515 [CC]	proteasome storage granule	confident	GO:0043234, GO:0005737, GO:0032991, GO:0044445, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0031597, GO:0044424, GO:0000502
GO:0005488 [MF]	binding	confident	GO:0003674
GO:0005875 [CC]	microtubule associated complex	confident	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0010499 [BP]	proteasomal ubiquitin-independent protein catabolic process	confident	GO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0010498, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0044238, GO:0009057
GO:0048046 [CC]	apoplast	confident	GO:0005575, GO:0005576
GO:0005774 [CC]	vacuolar membrane	confident	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006950 [BP]	response to stress	confident	GO:0050896, GO:0008150
GO:0043161 [BP]	proteasomal ubiquitin-dependent protein catabolic process	confident	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0005739 [CC]	mitochondrion	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031981 [CC]	nuclear lumen	confident	GO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0016071 [BP]	mRNA metabolic process	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0006977 [BP]	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	probable	GO:0051726, GO:0044699, GO:0010948, GO:0044773, GO:0044774, GO:0007165, GO:0035556, GO:0072331, GO:0050789, GO:0072401, GO:0090068, GO:0051716, GO:2000134, GO:0031570, GO:0031571, GO:0072395, GO:0010564, GO:0071158, GO:0065007, GO:1901988, GO:0048518, GO:0048519, GO:0071156, GO:1901990, GO:0030330, GO:0008150, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0044763, GO:0023052, GO:0007154, GO:0072413, GO:0042770, GO:0044700, GO:0007049, GO:0000077, GO:2000045, GO:0000075, GO:0072431, GO:0022402, GO:0072422, GO:0033554, GO:1901991, GO:0044783, GO:0007093, GO:0050896, GO:0048523, GO:0048522
GO:0009524 [CC]	phragmoplast	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0006521 [BP]	regulation of cellular amino acid metabolic process	probable	GO:0080090, GO:0019222, GO:0031323, GO:0010565, GO:0050794, GO:0033238, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0000084 [BP]	S phase of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]	G1/S transition of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0016363 [CC]	nuclear matrix	probable	GO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0019773 [CC]	proteasome core complex, alpha-subunit complex	probable	GO:0043234, GO:0032991, GO:0005839, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0000209 [BP]	protein polyubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0009409 [BP]	response to cold	probable	GO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0004298 [MF]	threonine-type endopeptidase activity	probable	GO:0016787, GO:0004175, GO:0003824, GO:0070003, GO:0070011, GO:0003674, GO:0008233
GO:0042981 [BP]	regulation of apoptotic process	probable	GO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0001673 [CC]	male germ cell nucleus	probable	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0030017 [CC]	sarcomere	probable	GO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000216 [BP]	M/G1 transition of mitotic cell cycle	probable
GO:0051437 [BP]	positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	probable	GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051439, GO:0051438, GO:0050789, GO:0007049, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044699, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0043085, GO:0009987, GO:0000278, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0044763, GO:0032268, GO:0051443, GO:0022402, GO:0031401, GO:0051351, GO:0008150, GO:0044093, GO:0048522
GO:0051436 [BP]	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	probable	GO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0022402, GO:0051438, GO:0043086, GO:0044699, GO:0051248, GO:0051340, GO:0010605, GO:0051246, GO:0050789, GO:0065007, GO:0007049, GO:0044092, GO:0031396, GO:0031397, GO:0065009, GO:0009987, GO:0000278, GO:0060255, GO:0051439, GO:0050790, GO:0050794, GO:0044763, GO:0048519, GO:0051444, GO:0032269, GO:0032268, GO:0031400, GO:0051352, GO:0008150, GO:0048523
GO:0002479 [BP]	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	probable	GO:0002474, GO:0019882, GO:0019884, GO:0002478, GO:0002376, GO:0042590, GO:0008150, GO:0048002
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005819 [CC]	spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005844 [CC]	polysome	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0031145 [BP]	anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0010467 [BP]	gene expression	probable	GO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006972 [BP]	hyperosmotic response	probable	GO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0010043 [BP]	response to zinc ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0006833 [BP]	water transport	probable	GO:0042044, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0044351 [BP]	macropinocytosis	probable	GO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0051788 [BP]	response to misfolded protein	probable	GO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0042175 [CC]	nuclear outer membrane-endoplasmic reticulum membrane network	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0019048 [BP]	virus-host interaction	probable	GO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0006094 [BP]	gluconeogenesis	probable	GO:1901576, GO:0005975, GO:0044238, GO:0005996, GO:0019318, GO:0019319, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0046364, GO:0044723, GO:0006006
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0040015 [BP]	negative regulation of multicellular organism growth	probable	GO:0045926, GO:0040014, GO:0040008, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0050789
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0006096 [BP]	glycolysis	probable	GO:0071704, GO:0019320, GO:1901575, GO:0005975, GO:0044238, GO:0046365, GO:0005996, GO:0009987, GO:0019318, GO:0044237, GO:0016052, GO:0008150, GO:0008152, GO:0044723, GO:0006091, GO:0006007, GO:0009056, GO:0006006, GO:0044724
GO:0051059 [MF]	NF-kappaB binding	probable	GO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0009853 [BP]	photorespiration	probable	GO:0043094, GO:0009987, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152
GO:0030010 [BP]	establishment of cell polarity	probable	GO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018996 [BP]	molting cycle, collagen and cuticulin-based cuticle	probable	GO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0042742 [BP]	defense response to bacterium	probable	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0004540 [MF]	ribonuclease activity	probable	GO:0004518, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0001530 [MF]	lipopolysaccharide binding	probable	GO:0003674, GO:0008289, GO:0005488
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0009651 [BP]	response to salt stress	probable	GO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0080129 [BP]	proteasome core complex assembly	probable	GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0043248, GO:0034622, GO:0043623, GO:0071840
GO:0051092 [BP]	positive regulation of NF-kappaB transcription factor activity	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0002009 [BP]	morphogenesis of an epithelium	probable	GO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.4.-.-	Acting on peptide bonds (peptide hydrolases).	probable
3.4.25.-	Threonine endopeptidases.	probable
3.4.25.1	Transferred entry: 3.4.25.1.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRU, chain G
Confidence level:very confident
Coverage over the Query: 2-245
View the alignment between query and template
View the model in PyMOL