Diaphorina citri psyllid: psy14464


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MLIISHSITSIIKQGVDILKRLYMSKNENIRVRALVGLCKLGSMGGSDASIRPFADGSTRKLAEACRRFLVNPARDPDIRRWAAEGLAYLTLDAEVKEALIEDKPALAALVDVASSGKPACTYGVVTTLVNLCNAYDKQEIIPEMIELAKFAKHHIPEDHELDDPDFVTKRLLVL
ccEEcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHcc
**IISHSITSIIKQGVDILKRLYMSKNENIRVRALVGLCKLGSMG*S**SIRPFADGSTRKLAEACRRFLVNPARDPDIRRWAAEGLAYLTLDAEVKEALIEDKPALAALVDVASSGKPACTYGVVTTLVNLCNAYDKQEIIPEMIELAKFAKHHIP********DFVTKRLLVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIISHSITSIIKQGVDILKRLYMSKNENIRVRALVGLCKLGSMGGSDASIRPFADGSTRKLAEACRRFLVNPARDPDIRRWAAEGLAYLTLDAEVKEALIEDKPALAALVDVASSGKPACTYGVVTTLVNLCNAYDKQEIIPEMIELAKFAKHHIPEDHELDDPDFVTKRLLVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein unc-45 homolog B Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain. Plays a role in sarcomere formation during muscle cell development.confidentQ8CGY6
Protein unc-45 homolog B Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain (By similarity). Plays a role in sarcomere formation during muscle cell development.confidentD7REX8
Protein unc-45 homolog B Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain (By similarity). Plays a role in sarcomere formation during muscle cell development. Required for myoseptal integrity, myofiber attachment, motility and craniofacial development.confidentQ6DGE9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0061077 [BP]chaperone-mediated protein foldingprobableGO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0007525 [BP]somatic muscle developmentprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0061061, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051879 [MF]Hsp90 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0031034 [BP]myosin filament assemblyprobableGO:0006996, GO:0022607, GO:0031033, GO:0030029, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0030036, GO:0065003, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0034622, GO:0007010, GO:0009987, GO:0043623, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NOW, chain A
Confidence level:very confident
Coverage over the Query: 5-174
View the alignment between query and template
View the model in PyMOL