Diaphorina citri psyllid: psy14478

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMAFYFLYKGFPGVKTSLYSSYLSTWMALFQITLGDYNYPELSYTVYPTMSKIVFTVFMVLVPILLLNMLIAMMGNTYAHVIEQSEKEWMKQWAKIVVALERAVSQEDCHRYLQEYSIKLGPGDEPGTEQRGVLVIKSKTAPEEPAPKFEAFSAALDVMAFTHDIDLGNT
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcHHcccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHccccccccc
**DKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMAFYFLYKGFPGVKTSLYSSYLSTWMALFQITLGDYNYPELSYTVYPTMSKIVFTVFMVLVPILLLNMLIAMMGNTYAHVIEQSEKEWMKQWAKIVVALERAVSQEDCHRYLQEYSIKLGPGDEPGTEQRGVL****************AFSAALDVMAFTHD**L***
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMAFYFLYKGFPGVKTSLYSSYLSTWMALFQITLGDYNYPELSYTVYPTMSKIVFTVFMVLVPILLLNMLIAMMGNTYAHVIEQSEKEWMKQWAKIVVALERAVSQEDCHRYLQEYSIKLGPGDEPGTEQRGVLVIKSKTAPEEPAPKFEAFSAALDVMAFTHDIDLGNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005261 [MF]cation channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0009628 [BP]response to abiotic stimulusprobableGO:0050896, GO:0008150
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0065007 [BP]biological regulationprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F4L, chain A
Confidence level:probable
Coverage over the Query: 49-110
View the alignment between query and template
View the model in PyMOL