Diaphorina citri psyllid: psy14484

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MNNIVYFKKKSSNNLVIRSLKNSWKWSLIDVSGKRYLDAISSWWVNLFGHSNSYINKALKNQLNKLEHVMLSNLTHKPVIKLSEKLSSLTQYKLGHCFYGSDGASAVEVALKMSFHYWYNKGFLNKKKFICLQNSYHGETLGALAVTNIQSFKEIYTSLLNKTYIITTPDSRNINKGNSANEIARCAIFDLEILLKKNHNKIAAIIIEPLVQCAGGMIMYDSIYLKLVREICNNYNIHLIADEIAVGCGRTGKFFACEHAEIWPDFLCLSKGITGGYLPLSLVMTTDKIYNSIYYKNNINIFLHSHSYSGNPLACCAALATLEIFNKDNILQRISQDMKKITKALTSLITHPKIINFRQKGMIWAFDVIIEDPEQIETFSKKFFVAALKNELLLRPIGNTVYLMPPYILNKNEIQHMTSAIFQTFNEVIT
ccccccccccccccccEEEEcccccEEEEEccccEEEEEHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccHHHHHHHcccccEECcccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHcccccccHHHHHcccccccHHHHHHccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHcccEEcccccEEEEcccccccHHHHHHHHHHHHHHHHHHHc
MNNIVYFKKKSSNNLVIRSLKNSWKWSLIDVSGKRYLDAISSWWVNLFGHSNSYINKALKNQLNKLEHVMLSNLTHKPVIKLSEKLSSLTQYKLGHCFYGSDGASAVEVALKMSFHYWYNKGFLNKKKFICLQNSYHGETLGALAVTNIQSFKEIYTSLLNKTYIITTPDSRNINKGNSANEIARCAIFDLEILLKKNHNKIAAIIIEPLVQCAGGMIMYDSIYLKLVREICNNYNIHLIADEIAVGCGRTGKFFACEHAEIWPDFLCLSKGITGGYLPLSLVMTTDKIYNSIYYKNNINIFLHSHSYSGNPLACCAALATLEIFNKDNILQRISQDMKKITKALTSLITHPKIINFRQKGMIWAFDVIIEDPEQIETFSKKFFVAALKNELLLRPIGNTVYLMPPYILNKNEIQHMTSAIFQTFNEVIT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNIVYFKKKSSNNLVIRSLKNSWKWSLIDVSGKRYLDAISSWWVNLFGHSNSYINKALKNQLNKLEHVMLSNLTHKPVIKLSEKLSSLTQYKLGHCFYGSDGASAVEVALKMSFHYWYNKGFLNKKKFICLQNSYHGETLGALAVTNIQSFKEIYTSLLNKTYIITTPDSRNINKGNSANEIARCAIFDLEILLKKNHNKIAAIIIEPLVQCAGGMIMYDSIYLKLVREICNNYNIHLIADEIAVGCGRTGKFFACEHAEIWPDFLCLSKGITGGYLPLSLVMTTDKIYNSIYYKNNINIFLHSHSYSGNPLACCAALATLEIFNKDNILQRISQDMKKITKALTSLITHPKIINFRQKGMIWAFDVIIEDPEQIETFSKKFFVAALKNELLLRPIGNTVYLMPPYILNKNEIQHMTSAIFQTFNEVIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only animotransferase known to utilize SAM as an amino donor.confidentQ74CT9
Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only animotransferase known to utilize SAM as an amino donor.confidentB7GHM5
Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only animotransferase known to utilize SAM as an amino donor.confidentQ89AK4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009102 [BP]biotin biosynthetic processprobableGO:0019752, GO:0042364, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044711, GO:0044283, GO:1901362, GO:0072330, GO:1901360, GO:1901576, GO:0044710, GO:0051186, GO:0071704, GO:0006082, GO:0018130, GO:0006767, GO:0006766, GO:0009987, GO:0006768, GO:0032787, GO:0009058, GO:0009110, GO:0008150, GO:0008152, GO:0043436, GO:1901564, GO:0046483, GO:0043604, GO:0044271, GO:1901566, GO:0043603, GO:0044272, GO:0046394, GO:0016053, GO:0044237, GO:0006790
GO:0004015 [MF]adenosylmethionine-8-amino-7-oxononanoate transaminase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0035690 [BP]cellular response to drugprobableGO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0047589 [MF]5-aminovalerate transaminase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0019477 [BP]L-lysine catabolic processprobableGO:0019752, GO:0009063, GO:0006807, GO:0009066, GO:0044282, GO:0009068, GO:0044712, GO:1901575, GO:0006520, GO:0046440, GO:0071704, GO:1901605, GO:1901606, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0006554, GO:0006553, GO:0044237, GO:0016054, GO:0044281

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.6.-.-Transferring nitrogenous groups.probable
2.6.1.-Transaminases (aminotransferases).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A0G, chain A
Confidence level:very confident
Coverage over the Query: 13-428
View the alignment between query and template
View the model in PyMOL