Diaphorina citri psyllid: psy14494

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470

MEVYCVFIFDKNILDPLRSQGIIEDRRIEFIFKSIIELSINLQNYDSDLIIRYAIASKEIKKLVIKLNIDAVMINHDYEPQAIIRDKLIKKELKVIGCKFFSYKDQVIFEKNEILNKTGKPYSIFSFYQKKWIEKVKSNKCYLQSYPVKSYLNNLVHSSKLHKIINNNIISLNDLGFCKSNLSSLGIKTGASGAKILLNNFIKKIKNYNINRNYPSINGTSYLSIHLRFGTISIRKLVKLIFKFIKKHYKTDCIGYFTWLSQLIWRDFYQMILYCYPNVVNKSFKKEYDNILWESDNYAKKNFLNWCKGYTGYPLIDSAIIQLNSSGYMHNRLRMVTASFLIKNMGINWKWGENYFANKLNDFDLASNNGNWQWSASSGCSSQPFFRIFNPIIQSKKFDYQGIFIRKYLPQLSKLSNKYIHSPWKASSYKLEKAGIILGKNYPKPILEHSLSKKNILKRYNFIKNILNRN

ccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEcccEEEcccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHccccccccccccccHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Deoxyribodipyrimidine photo-lyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.	confident	Q04449
Deoxyribodipyrimidine photo-lyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.	confident	P57386
Deoxyribodipyrimidine photo-lyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.	confident	Q89AJ9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006281 [BP]	DNA repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0009416 [BP]	response to light stimulus	probable	GO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0003904 [MF]	deoxyribodipyrimidine photo-lyase activity	probable	GO:0003824, GO:0016829, GO:0016830, GO:0003674, GO:0003913
GO:0003676 [MF]	nucleic acid binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0005488
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003914 [MF]	DNA (6-4) photolyase activity	probable	GO:0003824, GO:0016829, GO:0016830, GO:0003674, GO:0003913
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FY4, chain A
Confidence level:very confident
Coverage over the Query: 2-467
View the alignment between query and template
View the model in PyMOL