Diaphorina citri psyllid: psy14498


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNISNNLENNFFNIMSARKNYTSNTNNEKEKSKENFKTQPLPISNFLEADDDVPF
cccccEEEEEccccccccEEEcccccEEEEEEccccccECccccccCEccccEEEEEEEHHHHHHHHHHHHcccEEEEEEEEcccccccccccEEEEEEEEEccEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*ASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNM***********************************************************ADDDVPF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNISNNLENNFFNIMSARKNYTSNTNNEKEKSKENFKTQPLPISNFLEADDDVPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Single-stranded DNA-binding protein This protein is essential for replication of the chromosome. It is also involved in DNA recombination and repair.very confidentQ89A53
Single-stranded DNA-binding protein This protein is essential for replication of the chromosome. It is also involved in DNA recombination and repair.very confidentQ8K933
Single-stranded DNA-binding protein This protein is essential for replication of the chromosome. It is also involved in DNA recombination and repair.confidentP0AGE1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006260 [BP]DNA replicationprobableGO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483
GO:0006298 [BP]mismatch repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0042645 [CC]mitochondrial nucleoidprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0000725 [BP]recombinational repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0051096 [BP]positive regulation of helicase activityprobableGO:0051336, GO:0051345, GO:0051095, GO:0050790, GO:0050789, GO:0065007, GO:0044093, GO:0008150, GO:0019222, GO:0065009, GO:0043085
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0009432 [BP]SOS responseprobableGO:0031668, GO:0071496, GO:0009605, GO:0050896, GO:0009987, GO:0051716, GO:0008150, GO:0006950, GO:0044763, GO:0044699, GO:0033554, GO:0007154, GO:0009991
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TQY, chain A
Confidence level:very confident
Coverage over the Query: 2-104
View the alignment between query and template
View the model in PyMOL