Psyllid ID: psy14498

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNISNNLENNFFNIMSARKNYTSNTNNEKEKSKENFKTQPLPISNFLEADDDVPF
cccccEEEEEccccccccEEEcccccEEEEEEccccccEEccccccEEccccEEEEEEEHHHHHHHHHHHHcccEEEEEEEEcccccccccccEEEEEEEEEccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEEEEEEEccccEEEEcccccEEEEEEEEEEEEEccccccccEEEEEEEEEEEEcHHHHHHHHHcccccEEEEEEEEEEEEEccccccEEEEEEEEcccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MASVNKVIIIgnlgrdpetrymsngdavtNVSIattenwrdknsgekrelTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQmlgsrkntnekniSNNLENNFFNIMSARKNytsntnnekekskenfktqplpisnfleadddvpf
masvnkviiignlgrdpetrymsngdavtnvsiattenwrdknsgekreltewhrITFYRKLAQIVKQYLKKGSqiyiegrlqtrkwtnkegVEKYITEVIADNMQMLGSRKNTNEKNISNNLENNFFNIMSARKNYTSNtnnekekskenfktqplpisnfleadddvpf
MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRkntneknisnnlennffniMSARKNYtsntnnekekskenfktQPLPISNFLEADDDVPF
*****KVIIIGNLGR*****YM**GDAVTNVSIATTENW*********ELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNM*********************FF*******************************************
*ASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNM***********************************************************ADDDVPF
MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENW*********ELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNISNNLENNFFNIMSARKNYT**************KTQPLPISNFLEADDDVPF
*ASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQML***************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNISNNLENNFFNIMSARKNYTSNTNNEKEKSKENFKTQPLPISNFLEADDDVPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
P59927188 Single-stranded DNA-bindi yes N/A 0.988 0.898 0.461 5e-44
P59930176 Single-stranded DNA-bindi yes N/A 0.994 0.965 0.463 5e-43
P44409168 Single-stranded DNA-bindi yes N/A 0.976 0.994 0.476 7e-43
Q89A53166 Single-stranded DNA-bindi yes N/A 0.941 0.969 0.517 1e-41
Q82S98149 Single-stranded DNA-bindi yes N/A 0.871 1.0 0.479 2e-41
Q8Y2B4178 Single-stranded DNA-bindi yes N/A 0.643 0.617 0.666 8e-41
Q8K933162 Single-stranded DNA-bindi yes N/A 0.918 0.969 0.517 9e-41
Q9KUW2177 Single-stranded DNA-bindi yes N/A 1.0 0.966 0.446 2e-40
Q8L2A6195 Single-stranded DNA-bindi N/A N/A 1.0 0.876 0.463 8e-40
Q9RHF4178 Single-stranded DNA-bindi N/A N/A 0.918 0.882 0.454 6e-39
>sp|P59927|SSB_CUPNH Single-stranded DNA-binding protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ssb PE=3 SV=1 Back     alignment and function desciption
 Score =  176 bits (447), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 116/171 (67%), Gaps = 2/171 (1%)

Query: 1   MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYR 60
           MASVNKVI++GNLG DPE RYM +GDAV N+ IATT+ ++DK SGE +E TEWHR++ + 
Sbjct: 1   MASVNKVILVGNLGADPEVRYMPSGDAVANLRIATTDRYKDKQSGEMKEATEWHRVSMFG 60

Query: 61  KLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNIS 120
           KLA+I  QYL+KGS +YIEGR++TRKW ++ G +KY TE++AD MQMLG R   ++ +  
Sbjct: 61  KLAEIAGQYLRKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVADQMQMLGGRGGASDGDSD 120

Query: 121 NNLENNFFNIMSARKNYTSNTNNEKEKSKENFKTQPLPISNFLEADDDVPF 171
           +  + +      A    ++ T   +  ++     QP P + F + ++D+PF
Sbjct: 121 SGTDRSASQQSPASAQRSAPTGQRQPPARRQ-PAQP-PSNGFGDFNEDIPF 169
This protein is essential for replication of the chromosome. It is also involved in DNA recombination and repair.
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (taxid: 381666)
>sp|P59930|SSB_HAEDU Single-stranded DNA-binding protein OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|P44409|SSB_HAEIN Single-stranded DNA-binding protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|Q89A53|SSB_BUCBP Single-stranded DNA-binding protein OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|Q82S98|SSB_NITEU Single-stranded DNA-binding protein OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|Q8Y2B4|SSB_RALSO Single-stranded DNA-binding protein OS=Ralstonia solanacearum (strain GMI1000) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|Q8K933|SSB_BUCAP Single-stranded DNA-binding protein OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|Q9KUW2|SSB_VIBCH Single-stranded DNA-binding protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|Q8L2A6|SSB_PROVU Single-stranded DNA-binding protein OS=Proteus vulgaris GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|Q9RHF4|SSB2_SALTI Single-stranded DNA-binding protein 2 OS=Salmonella typhi GN=ssb2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
340785670190 single-stranded DNA-binding protein [Col 0.959 0.863 0.619 2e-55
300313248173 ssDNA-binding protein [Herbaspirillum se 1.0 0.988 0.583 4e-53
399018108168 single stranded DNA-binding protein [Her 0.976 0.994 0.587 3e-52
409407736173 single-strand DNA-binding protein (helix 1.0 0.988 0.583 2e-51
134096251161 ssDNA-binding protein controls activity 0.941 1.0 0.573 1e-50
398835869177 single stranded DNA-binding protein [Her 0.654 0.632 0.812 1e-50
152980525162 single-strand DNA-binding protein [Janth 0.947 1.0 0.567 1e-49
415918197123 Single-stranded DNA-binding protein, par 0.631 0.878 0.824 5e-49
325981395150 single-strand binding protein [Nitrosomo 0.877 1.0 0.532 6e-46
301631445171 PREDICTED: single-stranded DNA-binding p 0.994 0.994 0.505 7e-46
>gi|340785670|ref|YP_004751135.1| single-stranded DNA-binding protein [Collimonas fungivorans Ter331] gi|340550937|gb|AEK60312.1| Single-stranded DNA-binding protein [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/171 (61%), Positives = 131/171 (76%), Gaps = 7/171 (4%)

Query: 1   MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYR 60
           MASVNKVII+GNLGRDPETRYM NG+AVTN+++ATTE+W+DKNSGEK+ELTEWHRITFYR
Sbjct: 27  MASVNKVIIVGNLGRDPETRYMPNGEAVTNIAVATTESWKDKNSGEKKELTEWHRITFYR 86

Query: 61  KLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNIS 120
           KLA+I  QYLKKGSQIYIEGRLQTRKW +K+G E+Y TE+IAD MQMLGSR+       S
Sbjct: 87  KLAEIAGQYLKKGSQIYIEGRLQTRKWQDKDGAERYTTEIIADTMQMLGSRQGAGG---S 143

Query: 121 NNLENNFFNIMSARKNYTSNTNNEKEKSKENFKTQPLPISNFLEADDDVPF 171
             ++   +N  SA      NT+     +++   ++P P  NF + DDD+PF
Sbjct: 144 APMDGGDYN--SAPPARQQNTSAPAAPARQAPASRPAP--NFSDMDDDIPF 190

Source: Collimonas fungivorans Ter331

Species: Collimonas fungivorans

Genus: Collimonas

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|300313248|ref|YP_003777340.1| ssDNA-binding protein [Herbaspirillum seropedicae SmR1] gi|124483560|emb|CAM32653.1| single-strand DNA-binding protein (helix-destabilizing protein) [Herbaspirillum seropedicae] gi|300076033|gb|ADJ65432.1| single-strand DNA-binding protein (helix-destabilizing protein) [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|399018108|ref|ZP_10720293.1| single stranded DNA-binding protein [Herbaspirillum sp. CF444] gi|398101894|gb|EJL92091.1| single stranded DNA-binding protein [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|409407736|ref|ZP_11256187.1| single-strand DNA-binding protein (helix-destabilizing protein) [Herbaspirillum sp. GW103] gi|386433487|gb|EIJ46313.1| single-strand DNA-binding protein (helix-destabilizing protein) [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|134096251|ref|YP_001101326.1| ssDNA-binding protein controls activity of RecBCD nuclease [Herminiimonas arsenicoxydans] gi|133740154|emb|CAL63205.1| Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|398835869|ref|ZP_10593223.1| single stranded DNA-binding protein [Herbaspirillum sp. YR522] gi|398214688|gb|EJN01260.1| single stranded DNA-binding protein [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|152980525|ref|YP_001355029.1| single-strand DNA-binding protein [Janthinobacterium sp. Marseille] gi|151280602|gb|ABR89012.1| single-strand DNA-binding protein [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|415918197|ref|ZP_11554194.1| Single-stranded DNA-binding protein, partial [Herbaspirillum frisingense GSF30] gi|407761252|gb|EKF70352.1| Single-stranded DNA-binding protein, partial [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|325981395|ref|YP_004293797.1| single-strand binding protein [Nitrosomonas sp. AL212] gi|325530914|gb|ADZ25635.1| single-strand binding protein [Nitrosomonas sp. AL212] Back     alignment and taxonomy information
>gi|301631445|ref|XP_002944808.1| PREDICTED: single-stranded DNA-binding protein-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
TIGR_CMR|CBU_0271158 CBU_0271 "single-strand bindin 0.631 0.683 0.629 1.5e-37
UNIPROTKB|P0AGE0178 ssb "ssDNA-binding protein" [E 0.649 0.623 0.586 4e-37
UNIPROTKB|Q9KUW2177 ssb "Single-stranded DNA-bindi 0.649 0.627 0.606 4e-37
TIGR_CMR|VC_0397177 VC_0397 "single-strand binding 0.649 0.627 0.606 4e-37
TIGR_CMR|SO_4028238 SO_4028 "single-strand binding 0.643 0.462 0.577 5.7e-36
TIGR_CMR|GSU_3117146 GSU_3117 "single-strand bindin 0.643 0.753 0.522 7.7e-31
TIGR_CMR|NSE_0759151 NSE_0759 "single-strand bindin 0.573 0.649 0.535 2e-30
TIGR_CMR|SPO_1637180 SPO_1637 "single-strand bindin 0.578 0.55 0.56 6.2e-30
TIGR_CMR|GSU_2151139 GSU_2151 "single-strand bindin 0.643 0.791 0.504 5e-28
TIGR_CMR|ECH_0815157 ECH_0815 "single-strand bindin 0.573 0.624 0.545 3.2e-26
TIGR_CMR|CBU_0271 CBU_0271 "single-strand binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
 Score = 382 (139.5 bits), Expect = 1.5e-37, Sum P(2) = 1.5e-37
 Identities = 68/108 (62%), Positives = 89/108 (82%)

Query:     4 VNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLA 63
             VNKVI+IGNLG+DPE RY  NG+AV NV++AT+  WRDK +GE +E TEWHRI F+ +LA
Sbjct:     5 VNKVILIGNLGQDPEVRYTPNGNAVANVTLATSTTWRDKQTGELQERTEWHRIAFFNRLA 64

Query:    64 QIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSR 111
             +IV +YL+KGS+IYIEG L+TRKW +K GV++Y TE+IA+ M ML +R
Sbjct:    65 EIVGEYLRKGSKIYIEGSLRTRKWQDKNGVDRYTTEIIANEMHMLDNR 112
GO:0003697 "single-stranded DNA binding" evidence=ISS
GO:0006260 "DNA replication" evidence=ISS
GO:0006281 "DNA repair" evidence=ISS
GO:0006310 "DNA recombination" evidence=ISS
UNIPROTKB|P0AGE0 ssb "ssDNA-binding protein" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUW2 ssb "Single-stranded DNA-binding protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0397 VC_0397 "single-strand binding protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4028 SO_4028 "single-strand binding protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3117 GSU_3117 "single-strand binding protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0759 NSE_0759 "single-strand binding protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1637 SPO_1637 "single-strand binding protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2151 GSU_2151 "single-strand binding protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0815 ECH_0815 "single-strand binding protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q82S98SSB_NITEUNo assigned EC number0.47950.87131.0yesN/A
Q98M41SSB_RHILONo assigned EC number0.51280.65490.6511yesN/A
Q8EA81SSB_SHEONNo assigned EC number0.51900.73090.5252yesN/A
P28046SSB_PROMINo assigned EC number0.58330.67250.6609yesN/A
P0A2F6SSB_SALTYNo assigned EC number0.57890.63150.6136yesN/A
Q9PHE7SSB1_XYLFANo assigned EC number0.55170.67830.8529yesN/A
Q8Y2B4SSB_RALSONo assigned EC number0.66660.64320.6179yesN/A
P59928SSB_BORPANo assigned EC number0.64220.63150.6666yesN/A
P59927SSB_CUPNHNo assigned EC number0.46190.98830.8989yesN/A
Q8DCJ0SSB_VIBVUNo assigned EC number0.58470.65490.6256yesN/A
Q89L50SSB_BRAJANo assigned EC number0.60390.58470.6097yesN/A
P66848SSB_NEIMANo assigned EC number0.44060.96490.9482yesN/A
P66849SSB_NEIMBNo assigned EC number0.44060.96490.9482yesN/A
P66846SSB_BORPENo assigned EC number0.64220.63150.6506yesN/A
P66847SSB_BORBRNo assigned EC number0.64220.63150.6506yesN/A
P0AGE1SSB_ECOL6No assigned EC number0.43251.00.9606yesN/A
P0AGE3SSB_SHIFLNo assigned EC number0.43251.00.9606yesN/A
Q9A894SSB_CAUCRNo assigned EC number0.53910.64320.6586yesN/A
Q8KB47SSB1_CHLTENo assigned EC number0.42010.91810.9691yesN/A
Q8ZJ06SSB_YERPENo assigned EC number0.59290.63150.5934yesN/A
P57610SSB_BUCAINo assigned EC number0.47720.97070.9707yesN/A
Q87LA3SSB_VIBPANo assigned EC number0.58110.64910.6306yesN/A
Q89A53SSB_BUCBPNo assigned EC number0.51700.94150.9698yesN/A
Q8K933SSB_BUCAPNo assigned EC number0.51700.91810.9691yesN/A
P40947SSB_PSEAENo assigned EC number0.53840.66660.6909yesN/A
Q9KUW2SSB_VIBCHNo assigned EC number0.44631.00.9661yesN/A
P59930SSB_HAEDUNo assigned EC number0.46320.99410.9659yesN/A
P44409SSB_HAEINNo assigned EC number0.47670.97660.9940yesN/A
Q8D254SSB_WIGBRNo assigned EC number0.48270.90050.9447yesN/A
Q8YHC2SSB_BRUMENo assigned EC number0.49160.67250.6845yesN/A
Q83EP4SSB_COXBUNo assigned EC number0.48520.90640.9810yesN/A
Q9CJP4SSB_PASMUNo assigned EC number0.45400.95320.9819yesN/A
Q88QK5SSB_PSEPKNo assigned EC number0.56880.61400.5801yesN/A
Q889U1SSB_PSESMNo assigned EC number0.56250.63150.5714yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 1e-65
PRK06863168 PRK06863, PRK06863, single-stranded DNA-binding pr 2e-61
PRK09010177 PRK09010, PRK09010, single-stranded DNA-binding pr 4e-59
TIGR00621164 TIGR00621, ssb, single stranded DNA-binding protei 9e-56
PRK05733172 PRK05733, PRK05733, single-stranded DNA-binding pr 3e-54
COG0629167 COG0629, Ssb, Single-stranded DNA-binding protein 3e-48
PRK06341166 PRK06341, PRK06341, single-stranded DNA-binding pr 4e-47
pfam00436104 pfam00436, SSB, Single-strand binding protein fami 5e-45
PRK13732175 PRK13732, PRK13732, single-stranded DNA-binding pr 3e-44
PRK08763164 PRK08763, PRK08763, single-stranded DNA-binding pr 1e-42
cd04496100 cd04496, SSB_OBF, SSB_OBF: A subfamily of OB folds 4e-42
PRK06642152 PRK06642, PRK06642, single-stranded DNA-binding pr 2e-34
PRK08486182 PRK08486, PRK08486, single-stranded DNA-binding pr 1e-28
PRK07275162 PRK07275, PRK07275, single-stranded DNA-binding pr 2e-22
PRK06751173 PRK06751, PRK06751, single-stranded DNA-binding pr 3e-21
PRK07274131 PRK07274, PRK07274, single-stranded DNA-binding pr 4e-17
PRK07459121 PRK07459, PRK07459, single-stranded DNA-binding pr 1e-16
PRK06752112 PRK06752, PRK06752, single-stranded DNA-binding pr 3e-13
PRK07772186 PRK07772, PRK07772, single-stranded DNA-binding pr 4e-13
PRK06293161 PRK06293, PRK06293, single-stranded DNA-binding pr 3e-09
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information 
 Score =  198 bits (504), Expect = 1e-65
 Identities = 68/111 (61%), Positives = 92/111 (82%)

Query: 1   MASVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYR 60
           MASVNKVI++GNLG DPE RY+ +GDAV N+ +ATT+ ++DK SGE +E TEWHR+ F+ 
Sbjct: 1   MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEATEWHRVAFFG 60

Query: 61  KLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSR 111
           +LA+IV +YLKKGS +YIEGR++TRKW  ++G ++Y TE++AD MQMLG R
Sbjct: 61  RLAEIVGEYLKKGSSVYIEGRIRTRKWQGQDGQDRYSTEIVADQMQMLGGR 111

Length = 182
>gnl|CDD|136097 PRK06863, PRK06863, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236362 PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233057 TIGR00621, ssb, single stranded DNA-binding protein (ssb) Back     alignment and domain information
>gnl|CDD|235585 PRK05733, PRK05733, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223702 COG0629, Ssb, Single-stranded DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235782 PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215919 pfam00436, SSB, Single-strand binding protein family Back     alignment and domain information
>gnl|CDD|184284 PRK13732, PRK13732, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181549 PRK08763, PRK08763, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|239942 cd04496, SSB_OBF, SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>gnl|CDD|135984 PRK06642, PRK06642, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236275 PRK08486, PRK08486, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180915 PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|168659 PRK06751, PRK06751, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180914 PRK07274, PRK07274, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180986 PRK07459, PRK07459, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|168660 PRK06752, PRK06752, single-stranded DNA-binding protein; Validated Back     alignment and domain information
>gnl|CDD|236092 PRK07772, PRK07772, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180517 PRK06293, PRK06293, single-stranded DNA-binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
PRK09010177 single-stranded DNA-binding protein; Provisional 100.0
PRK13732175 single-stranded DNA-binding protein; Provisional 100.0
PRK06863168 single-stranded DNA-binding protein; Provisional 100.0
PRK06958182 single-stranded DNA-binding protein; Provisional 100.0
PRK08763164 single-stranded DNA-binding protein; Provisional 100.0
PRK05733172 single-stranded DNA-binding protein; Provisional 100.0
PRK08486182 single-stranded DNA-binding protein; Provisional 100.0
PRK07275162 single-stranded DNA-binding protein; Provisional 100.0
TIGR00621164 ssb single stranded DNA-binding protein (ssb). Thi 100.0
PRK06751173 single-stranded DNA-binding protein; Provisional 100.0
PRK06341166 single-stranded DNA-binding protein; Provisional 100.0
PRK06642152 single-stranded DNA-binding protein; Provisional 100.0
PRK07274131 single-stranded DNA-binding protein; Provisional 100.0
PRK07459121 single-stranded DNA-binding protein; Provisional 100.0
PRK06752112 single-stranded DNA-binding protein; Validated 100.0
COG0629167 Ssb Single-stranded DNA-binding protein [DNA repli 100.0
PRK07772186 single-stranded DNA-binding protein; Provisional 100.0
PRK06293161 single-stranded DNA-binding protein; Provisional 100.0
PRK08182148 single-stranded DNA-binding protein; Provisional 100.0
PF00436104 SSB: Single-strand binding protein family; InterPr 99.97
PRK05853161 hypothetical protein; Validated 99.96
PRK02801101 primosomal replication protein N; Provisional 99.96
PRK05813219 single-stranded DNA-binding protein; Provisional 99.95
cd04496100 SSB_OBF SSB_OBF: A subfamily of OB folds similar t 99.94
PRK05813219 single-stranded DNA-binding protein; Provisional 99.9
KOG1653|consensus175 99.86
PRK00036107 primosomal replication protein N; Reviewed 99.28
COG2965103 PriB Primosomal replication protein N [DNA replica 99.21
PF0133675 tRNA_anti-codon: OB-fold nucleic acid binding doma 98.1
cd0448482 polC_OBF polC_OBF: A subfamily of OB folds corresp 97.5
PF1132584 DUF3127: Domain of unknown function (DUF3127); Int 97.42
cd04474104 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds cor 97.32
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB fol 97.24
PHA01740158 putative single-stranded DNA-binding protein 97.21
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB f 97.16
PRK07211 485 replication factor A; Reviewed 97.08
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligo 96.95
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB fol 96.93
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresp 96.82
PF11506104 DUF3217: Protein of unknown function (DUF3217); In 96.64
PF1374299 tRNA_anti_2: OB-fold nucleic acid binding domain 96.19
COG3390196 Uncharacterized protein conserved in archaea [Func 96.18
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds 96.16
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of unchara 95.94
PRK07373449 DNA polymerase III subunit alpha; Reviewed 95.76
PRK15491374 replication factor A; Provisional 95.73
cd04475101 RPA1_DBD_B RPA1_DBD_B: A subfamily of OB folds cor 95.64
PRK07211 485 replication factor A; Reviewed 95.49
PF12101137 DUF3577: Protein of unknown function (DUF3577); In 95.47
PRK15491 374 replication factor A; Provisional 95.08
PRK12366 637 replication factor A; Reviewed 95.04
PRK056731135 dnaE DNA polymerase III subunit alpha; Validated 95.0
PRK13480 314 3'-5' exoribonuclease YhaM; Provisional 94.92
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 94.79
PRK14699 484 replication factor A; Provisional 94.47
cd0449182 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds simil 94.4
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 93.82
PRK068261151 dnaE DNA polymerase III DnaE; Reviewed 93.66
cd0448875 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB f 93.6
PRK069201107 dnaE DNA polymerase III DnaE; Reviewed 93.32
PRK12366 637 replication factor A; Reviewed 93.05
PRK00448 1437 polC DNA polymerase III PolC; Validated 92.98
PRK073741170 dnaE DNA polymerase III subunit alpha; Validated 92.94
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 92.85
cd04481106 RPA1_DBD_B_like RPA1_DBD_B_like: A subgroup of unc 92.78
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticod 92.53
PRK08402 355 replication factor A; Reviewed 92.48
PRK06461129 single-stranded DNA-binding protein; Reviewed 92.32
COG1570 440 XseA Exonuclease VII, large subunit [DNA replicati 92.0
TIGR00617 608 rpa1 replication factor-a protein 1 (rpa1). This f 91.85
PRK072791034 dnaE DNA polymerase III DnaE; Reviewed 91.71
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon r 91.33
PRK14699484 replication factor A; Provisional 90.84
PF02765146 POT1: Telomeric single stranded DNA binding POT1/C 90.44
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, ant 89.8
PRK056721046 dnaE2 error-prone DNA polymerase; Validated 89.52
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, a 89.49
cd0432186 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, a 87.08
PHA00458233 single-stranded DNA-binding protein 85.83
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition 85.76
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 85.75
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticod 85.72
PF13567176 DUF4131: Domain of unknown function (DUF4131) 85.24
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds cor 84.14
TIGR00617 608 rpa1 replication factor-a protein 1 (rpa1). This f 83.93
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 83.86
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-posit 83.7
KOG3416|consensus134 83.58
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, a 83.26
PLN02850 530 aspartate-tRNA ligase 82.81
cd04497138 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB f 82.41
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 81.84
smart00350 509 MCM minichromosome maintenance proteins. 81.1
COG0017 435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl 80.8
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 80.72
>PRK09010 single-stranded DNA-binding protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.9e-45  Score=274.24  Aligned_cols=116  Identities=58%  Similarity=1.082  Sum_probs=109.3

Q ss_pred             CC--CccEEEEEEEeCCCCeEEEecCCcEEEEEEEEEecccccCCCCeeeeeceEEEEEEEhHHHHHHHHHcCCCCEEEE
Q psy14498          1 MA--SVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYI   78 (171)
Q Consensus         1 M~--~~N~v~l~G~l~~dp~~~~~~~g~~~~~~~la~~~~~~~~~~G~~~~~~~~~~v~~~g~~A~~~~~~l~kG~~V~V   78 (171)
                      |+  +||+|+|+|||++||++|++++|.++++|+||++++|+++++|++.++++||+|++|+++|+.+.++|+||++|+|
T Consensus         1 m~~r~~N~V~LiGrLg~DPelR~t~nG~~v~~fsVAvn~~~kd~~~Ge~~e~t~w~~V~~fgk~Ae~~~~~L~KGs~V~V   80 (177)
T PRK09010          1 MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYI   80 (177)
T ss_pred             CCccCceEEEEEEEeCCCceEEEcCCCCEEEEEEEEEcCccccCcccccccceEEEEEEEehhHHHHHHHhcCCCCEEEE
Confidence            65  7999999999999999999999999999999999999987779988899999999999999999999999999999


Q ss_pred             EeEeeeeeeecCCCcEEEEEEEEEe---EEEEccCCCCCCC
Q psy14498         79 EGRLQTRKWTNKEGVEKYITEVIAD---NMQMLGSRKNTNE  116 (171)
Q Consensus        79 ~G~l~~~~~~~kdG~~~~~~~i~a~---~i~~l~~~~~~~~  116 (171)
                      +|+|++++|+|++|++++.++|+|+   +|+||+++..+..
T Consensus        81 eGrL~~~~yedkdG~~r~~~eVvv~~~~~~~~l~~r~~~~~  121 (177)
T PRK09010         81 EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA  121 (177)
T ss_pred             EEEEEeccccCCCCCEEEEEEEEEecCCcEEEccCCCCCCC
Confidence            9999999999999999999999998   8999998855443

>PRK13732 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06863 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06958 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08763 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK05733 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08486 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07275 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>TIGR00621 ssb single stranded DNA-binding protein (ssb) Back     alignment and domain information
>PRK06751 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06341 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06642 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07274 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07459 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06752 single-stranded DNA-binding protein; Validated Back     alignment and domain information
>COG0629 Ssb Single-stranded DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07772 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06293 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08182 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PF00436 SSB: Single-strand binding protein family; InterPro: IPR000424 The Escherichia coli single-strand binding protein [] (gene ssb), also known as the helix-destabilising protein, is a protein of 177 amino acids Back     alignment and domain information
>PRK05853 hypothetical protein; Validated Back     alignment and domain information
>PRK02801 primosomal replication protein N; Provisional Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04496 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>KOG1653|consensus Back     alignment and domain information
>PRK00036 primosomal replication protein N; Reviewed Back     alignment and domain information
>COG2965 PriB Primosomal replication protein N [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands Back     alignment and domain information
>cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC) Back     alignment and domain information
>PF11325 DUF3127: Domain of unknown function (DUF3127); InterPro: IPR021474 This bacterial family of proteins has no known function Back     alignment and domain information
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>PHA01740 putative single-stranded DNA-binding protein Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>PF11506 DUF3217: Protein of unknown function (DUF3217); InterPro: IPR024506 This family of proteins with unknown function appears to be restricted to Mycoplasma Back     alignment and domain information
>PF13742 tRNA_anti_2: OB-fold nucleic acid binding domain Back     alignment and domain information
>COG3390 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>cd04475 RPA1_DBD_B RPA1_DBD_B: A subfamily of OB folds corresponding to the third OB fold, the ssDNA-binding domain (DBD)-B, of human RPA1 (also called RPA70) Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>PF12101 DUF3577: Protein of unknown function (DUF3577); InterPro: IPR021960 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB) Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>cd04488 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>cd04481 RPA1_DBD_B_like RPA1_DBD_B_like: A subgroup of uncharacterized, plant OB folds with similarity to the third OB fold, the ssDNA-binding domain (DBD)-B, of human RPA1 (also called RPA70) Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>PRK06461 single-stranded DNA-binding protein; Reviewed Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1) Back     alignment and domain information
>PRK07279 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>PF02765 POT1: Telomeric single stranded DNA binding POT1/CDC13; InterPro: IPR011564 This entry represents a domain that binds single stranded telomeric DNA and adopts an OB fold [] Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PHA00458 single-stranded DNA-binding protein Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>PF13567 DUF4131: Domain of unknown function (DUF4131) Back     alignment and domain information
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1) Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3416|consensus Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>cd04497 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB folds similar to the first OB fold (OB1) of human protection of telomeres 1 protein (hPOT1), the single OB fold of the N-terminal domain of Schizosaccharomyces pombe POT1 (SpPOT1), and the first OB fold of the N-terminal domain of the alpha subunit (OB1Nalpha) of Oxytricha nova telomere end binding protein (OnTEBP) Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
1eqq_A178 Single Stranded Dna Binding Protein And Ssdna Compl 8e-38
1kaw_A135 Structure Of Single Stranded Dna Binding Protein (S 2e-37
1qvc_A145 Crystal Structure Analysis Of Single Stranded Dna B 3e-37
1eyg_A116 Crystal Structure Of Chymotryptic Fragment Of E. Co 3e-37
3tqy_A158 Structure Of A Single-Stranded Dna-Binding Protein 4e-36
1sru_A113 Crystal Structure Of Full Length E. Coli Ssb Protei 6e-36
3pgz_A193 Crystal Structure Of A Single Strand Binding Protei 3e-31
3lgj_A169 Crystal Structure Of Single-Stranded Binding Protei 4e-24
3ulp_A124 Plasmodium Falciparum Ssb Complex With Ssdna Length 2e-19
3vdy_A116 B. Subtilis SsbbSSDNA Length = 116 8e-17
2dud_A133 Crystal Structure Of Human Mitochondrial Single-Str 4e-16
3ull_A132 Human Mitochondrial Single-Stranded Dna Binding Pro 4e-16
3udg_A301 Structure Of Deinococcus Radiodurans Ssb Bound To S 6e-16
1se8_A301 Structure Of Single-Stranded Dna-Binding Protein (S 1e-15
1z9f_A153 Crystal Structure Of Single Stranded Dna-Binding Pr 1e-15
3afp_A168 Crystal Structure Of The Single-Stranded Dna Bindin 3e-13
1x3e_A165 Crystal Structure Of The Single-Stranded Dna-Bindin 4e-13
3a5u_A130 Promiscuity And Specificity In Dna Binding To Ssb: 6e-13
1ue1_A164 Crystal Structure Of The Single-Stranded Dna-Bindin 2e-12
2vw9_A134 Single Stranded Dna Binding Protein Complex From He 6e-12
2ihf_A239 Crystal Structure Of Deletion Mutant Delta 228-252 1e-11
2fxq_A264 Single-Stranded Dna-Binding Protein From Thermus Aq 1e-11
3eiv_A199 Crystal Structure Of Single-Stranded Dna-Binding Pr 3e-10
2cwa_A263 Crystal Structure Of The Single-stranded Dna Bindin 4e-10
>pdb|1EQQ|A Chain A, Single Stranded Dna Binding Protein And Ssdna Complex Length = 178 Back     alignment and structure 
Iteration: 1

 Score =  152 bits (385), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 68/116 (58%), Positives = 93/116 (80%), Gaps = 5/116 (4%)
Query: 1   MAS--VNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITF 58
           MAS  VNKVI++GNLG+DPE RYM NG AV N+++AT+E+WRDK +GE +E TEWHR+  
Sbjct: 1   MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL 60
Query: 59  YRKLAQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIAD---NMQMLGSR 111
           + KLA++  +YL+KGSQ+YIEG+L+TRKWT++ G ++Y TEV+ +    MQMLG R
Sbjct: 61  FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGR 116
>pdb|1KAW|A Chain A, Structure Of Single Stranded Dna Binding Protein (Ssb) Length = 135 Back     alignment and structure
>pdb|1QVC|A Chain A, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli Length = 145 Back     alignment and structure
>pdb|1EYG|A Chain A, Crystal Structure Of Chymotryptic Fragment Of E. Coli Ssb Bound To Two 35-Mer Single Strand Dnas Length = 116 Back     alignment and structure
>pdb|3TQY|A Chain A, Structure Of A Single-Stranded Dna-Binding Protein (Ssb), From Coxiella Burnetii Length = 158 Back     alignment and structure
>pdb|1SRU|A Chain A, Crystal Structure Of Full Length E. Coli Ssb Protein Length = 113 Back     alignment and structure
>pdb|3PGZ|A Chain A, Crystal Structure Of A Single Strand Binding Protein (Ssb) From Bartonella Henselae Length = 193 Back     alignment and structure
>pdb|3LGJ|A Chain A, Crystal Structure Of Single-Stranded Binding Protein (Ssb) From Bartonella Henselae Length = 169 Back     alignment and structure
>pdb|3ULP|A Chain A, Plasmodium Falciparum Ssb Complex With Ssdna Length = 124 Back     alignment and structure
>pdb|3VDY|A Chain A, B. Subtilis SsbbSSDNA Length = 116 Back     alignment and structure
>pdb|2DUD|A Chain A, Crystal Structure Of Human Mitochondrial Single-Stranded Dna-Binding Protein(Hmtssb) Length = 133 Back     alignment and structure
>pdb|3ULL|A Chain A, Human Mitochondrial Single-Stranded Dna Binding Protein Length = 132 Back     alignment and structure
>pdb|3UDG|A Chain A, Structure Of Deinococcus Radiodurans Ssb Bound To Ssdna Length = 301 Back     alignment and structure
>pdb|1SE8|A Chain A, Structure Of Single-Stranded Dna-Binding Protein (Ssb) From D. Radiodurans Length = 301 Back     alignment and structure
>pdb|1Z9F|A Chain A, Crystal Structure Of Single Stranded Dna-Binding Protein (Tm0604) From Thermotoga Maritima At 2.60 A Resolution Length = 153 Back     alignment and structure
>pdb|3AFP|A Chain A, Crystal Structure Of The Single-Stranded Dna Binding Protein From Mycobacterium Leprae (Form I) Length = 168 Back     alignment and structure
>pdb|1X3E|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Smegmatis Length = 165 Back     alignment and structure
>pdb|3A5U|A Chain A, Promiscuity And Specificity In Dna Binding To Ssb: Insights From The Structure Of The Mycobacterium Smegmatis Ssb-Ssdna Complex Length = 130 Back     alignment and structure
>pdb|1UE1|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis Length = 164 Back     alignment and structure
>pdb|2VW9|A Chain A, Single Stranded Dna Binding Protein Complex From Helicobacter Pylori Length = 134 Back     alignment and structure
>pdb|2IHF|A Chain A, Crystal Structure Of Deletion Mutant Delta 228-252 R190a Of The Single-Stranded Dna Binding Protein From Thermus Aquaticus Length = 239 Back     alignment and structure
>pdb|2FXQ|A Chain A, Single-Stranded Dna-Binding Protein From Thermus Aquaticus Length = 264 Back     alignment and structure
>pdb|3EIV|A Chain A, Crystal Structure Of Single-Stranded Dna-Binding Protein From Streptomyces Coelicolor Length = 199 Back     alignment and structure
>pdb|2CWA|A Chain A, Crystal Structure Of The Single-stranded Dna Binding Protein From Thermus Thermophilus Hb8 Length = 263 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
1eqq_A178 Single stranded DNA binding protein; beta barrel, 3e-73
3tqy_A158 Single-stranded DNA-binding protein; DNA replicati 9e-73
3pgz_A193 Single-stranded DNA-binding protein; ssgcid, singl 8e-71
1qvc_A145 Single stranded DNA binding protein monomer; beta- 1e-68
1z9f_A153 Single-strand binding protein; TM0604, single stra 1e-67
3lgj_A169 Single-stranded DNA-binding protein; niaid, CAT sc 1e-66
3ull_A132 DNA binding protein; DNA replication, mitochondrio 5e-66
3afp_A168 Single-stranded DNA-binding protein; OB-fold, quat 9e-66
1se8_A301 Single-strand binding protein; DNA binding protein 1e-64
1se8_A 301 Single-strand binding protein; DNA binding protein 6e-62
2vw9_A134 Single-stranded DNA binding protein; DNA replicati 2e-63
3ulp_A124 Single-strand binding protein; OB-fold, DNA bindin 2e-63
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, 4e-62
2fxq_A264 Single-strand binding protein; strand beta-sheet e 6e-61
2fxq_A264 Single-strand binding protein; strand beta-sheet e 2e-57
3vdy_A116 SSB, single-stranded DNA-binding protein SSBB; OB 1e-60
3koj_A108 Uncharacterized protein YCF41; single-strand bindi 2e-40
3k7u_C148 MP18 RNA editing complex protein; OB-fold, RNA-edi 2e-21
3k81_C164 MP18 RNA editing complex protein; krepa6, single d 1e-15
1txy_A104 Primosomal replication protein N; OB fold, dimer, 2e-12
1v1q_A134 Primosomal replication protein N; primosome, DNA r 2e-11
3k8a_A103 Putative primosomal replication protein; beta-barr 3e-09
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RA 3e-09
3en2_A101 Probable primosomal replication protein N; PRIB RS 4e-05
>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} SCOP: b.40.4.3 Length = 178 Back     alignment and structure
 Score =  217 bits (553), Expect = 3e-73
 Identities = 74/174 (42%), Positives = 106/174 (60%), Gaps = 5/174 (2%)

Query: 3   SVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKL 62
            VNKVI++GNLG+DPE RYM NG AV N+++AT+E+WRDK +GE +E TEWHR+  + KL
Sbjct: 5   GVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKL 64

Query: 63  AQIVKQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIAD---NMQMLGSRKNTNEKNI 119
           A++  +YL+KGSQ+YIEG+L+TRKWT++ G ++Y TEV+ +    MQMLG R+       
Sbjct: 65  AEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAG 124

Query: 120 SNNLENNFFNIMSARKNYTSNTNNEKEKSKENFKTQPLPISN--FLEADDDVPF 171
            N             +                 ++ P   SN   ++ DDD+PF
Sbjct: 125 GNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF 178
>3tqy_A Single-stranded DNA-binding protein; DNA replication, transferase; 2.60A {Coxiella burnetii} Length = 158 Back     alignment and structure
>3pgz_A Single-stranded DNA-binding protein; ssgcid, single-strand binding protein, structural genomics center for infectious disease; 2.10A {Bartonella henselae} Length = 193 Back     alignment and structure
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Length = 145 Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural GENO joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Length = 153 Back     alignment and structure
>3lgj_A Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Length = 169 Back     alignment and structure
>3ull_A DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 PDB: 1s3o_A* 2dud_A Length = 132 Back     alignment and structure
>3afp_A Single-stranded DNA-binding protein; OB-fold, quaternary structure and stability, changes on oligomerisation, water-bridges, DNA damage; 2.05A {Mycobacterium leprae} PDB: 3afq_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A 1x3e_A 1x3f_A 1x3g_A 3a5u_A* Length = 168 Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Length = 301 Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Length = 301 Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Length = 134 Back     alignment and structure
>3ulp_A Single-strand binding protein; OB-fold, DNA binding, single-stranded DNA, apicoplast, DNA B protein-DNA complex; HET: DNA; 2.10A {Plasmodium falciparum} Length = 124 Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Length = 199 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Length = 264 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Length = 264 Back     alignment and structure
>3vdy_A SSB, single-stranded DNA-binding protein SSBB; OB fold; 2.80A {Bacillus subtilis} Length = 116 Back     alignment and structure
>3koj_A Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Length = 108 Back     alignment and structure
>3k7u_C MP18 RNA editing complex protein; OB-fold, RNA-editing proteins, kinetoplastids, system, RNA binding protein; 2.10A {Trypanosoma brucei} PDB: 3k80_D 3stb_D Length = 148 Back     alignment and structure
>3k81_C MP18 RNA editing complex protein; krepa6, single domain antibody, immune system, RNA BIND protein; 3.40A {Trypanosoma brucei} Length = 164 Back     alignment and structure
>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A 4apv_A Length = 104 Back     alignment and structure
>1v1q_A Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} SCOP: b.40.4.3 PDB: 2ccz_A Length = 134 Back     alignment and structure
>3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} Length = 103 Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Length = 115 Back     alignment and structure
>3en2_A Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Length = 101 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
1eqq_A178 Single stranded DNA binding protein; beta barrel, 100.0
3pgz_A193 Single-stranded DNA-binding protein; ssgcid, singl 100.0
3tqy_A158 Single-stranded DNA-binding protein; DNA replicati 100.0
3lgj_A169 Single-stranded DNA-binding protein; niaid, CAT sc 100.0
3afp_A168 Single-stranded DNA-binding protein; OB-fold, quat 100.0
1qvc_A145 Single stranded DNA binding protein monomer; beta- 100.0
1z9f_A153 Single-strand binding protein; TM0604, single stra 100.0
3ulp_A124 Single-strand binding protein; OB-fold, DNA bindin 100.0
2vw9_A134 Single-stranded DNA binding protein; DNA replicati 100.0
3vdy_A116 SSB, single-stranded DNA-binding protein SSBB; OB 100.0
3ull_A132 DNA binding protein; DNA replication, mitochondrio 100.0
1se8_A301 Single-strand binding protein; DNA binding protein 100.0
4dam_A128 Single-stranded DNA-binding protein 1; OB-fold; 1. 100.0
3koj_A108 Uncharacterized protein YCF41; single-strand bindi 100.0
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, 100.0
2fxq_A264 Single-strand binding protein; strand beta-sheet e 100.0
3k7u_C148 MP18 RNA editing complex protein; OB-fold, RNA-edi 100.0
1v1q_A134 Primosomal replication protein N; primosome, DNA r 100.0
3k81_C164 MP18 RNA editing complex protein; krepa6, single d 100.0
1se8_A 301 Single-strand binding protein; DNA binding protein 100.0
2fxq_A264 Single-strand binding protein; strand beta-sheet e 99.98
1txy_A104 Primosomal replication protein N; OB fold, dimer, 99.97
4dni_A257 Fusion protein of RNA-editing complex proteins MP 99.97
3k8a_A103 Putative primosomal replication protein; beta-barr 99.97
4gs3_A107 Single-stranded DNA-binding protein; primosome, ol 99.97
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RA 99.97
3en2_A101 Probable primosomal replication protein N; PRIB RS 99.94
3stb_C148 RNA-editing complex protein MP42; editosome, nanob 99.91
4dni_A257 Fusion protein of RNA-editing complex proteins MP 99.9
4dka_C105 RNA-editing complex protein MP81; krepa1, VHH, sin 98.18
3dm3_A105 Replication factor A; probably plays AN essential 97.22
3e0e_A97 Replication protein A; structural genomics, PSI-2, 97.0
2k50_A115 Replication factor A related protein; uncharacteri 96.65
2hql_A110 Hypothetical protein Mg376 homolog; structural gen 96.64
1ynx_A114 Replication factor-A protein 1; canonical OB fold, 96.63
3f2b_A 1041 DNA-directed DNA polymerase III alpha chain; DNA p 95.71
2k75_A106 Uncharacterized protein TA0387; closed beta barrel 95.09
1o7i_A119 SSB, SSO2364, single stranded DNA binding protein; 94.84
3au7_A402 TIAS, putative uncharacterized protein; ATP hydrol 94.27
1jmc_A246 Protein (replication protein A (RPA)); human ssDNA 94.19
2wkd_A119 ORF34P2; SSB, single-stranded DNA binding, DNA bin 92.71
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 92.67
4gop_C 444 Putative uncharacterized protein; OB fold, ssDNA b 91.59
2hpi_A1220 DNA polymerase III alpha subunit; POL-beta-like nu 91.41
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 88.64
4gop_B136 Putative uncharacterized protein; OB fold, ssDNA b 88.54
3kdf_D132 Replication protein A 32 kDa subunit; wheat GERM c 88.49
3kf8_A220 Protein STN1; OB fold; 2.40A {Candida tropicalis m 87.46
1jmc_A246 Protein (replication protein A (RPA)); human ssDNA 86.17
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 85.87
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 85.52
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 83.86
3kf6_A159 Protein STN1; OB fold, chromosomal protein, DNA-bi 83.6
3ebe_A200 Protein MCM10 homolog; OB-fold, zinc finger, CCCH, 81.25
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 80.75
>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} SCOP: b.40.4.3 Back     alignment and structure
Probab=100.00  E-value=6e-44  Score=268.49  Aligned_cols=114  Identities=59%  Similarity=1.095  Sum_probs=105.8

Q ss_pred             CC--CccEEEEEEEeCCCCeEEEecCCcEEEEEEEEEecccccCCCCeeeeeceEEEEEEEhHHHHHHHHHcCCCCEEEE
Q psy14498          1 MA--SVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYI   78 (171)
Q Consensus         1 M~--~~N~v~l~G~l~~dp~~~~~~~g~~~~~~~la~~~~~~~~~~G~~~~~~~~~~v~~~g~~A~~~~~~l~kG~~V~V   78 (171)
                      |+  |||+|+|+|||++||++|++++|+++|+|+||++++|+++++|+|+++++||+|++||++|+.+.++|+||++|+|
T Consensus         1 Ma~~~~N~V~LiGrL~~dPelr~t~~G~~v~~f~LAv~~~~~d~~~Ge~~~~t~~i~vv~wg~~Ae~~~~~l~KG~~V~V   80 (178)
T 1eqq_A            1 MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI   80 (178)
T ss_dssp             -CCCCEEEEEEEEEESSSCCCCEETTTEECCCCEEEEEECCCCSSSSSCCCEEEEEEEEECHHHHHHHHHHCCTTCEEEE
T ss_pred             CCccCeeEEEEEEEECCCCEEEECCCCCEEEEEEEEEcCCeecCCCCceecccEEEEEEEccHHHHHHHHhcCCCCEEEE
Confidence            77  8999999999999999999999999999999999999987779998899999999999999999999999999999


Q ss_pred             EeEeeeeeeecCCCcEEEEEEE---EEeEEEEccCCCCC
Q psy14498         79 EGRLQTRKWTNKEGVEKYITEV---IADNMQMLGSRKNT  114 (171)
Q Consensus        79 ~G~l~~~~~~~kdG~~~~~~~i---~a~~i~~l~~~~~~  114 (171)
                      +|+|++++|+|+||++++.++|   ++++|+||.++...
T Consensus        81 eGrL~~r~~~dkdG~~r~~~eI~v~va~~i~~l~~~~~~  119 (178)
T 1eqq_A           81 EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGG  119 (178)
T ss_dssp             CCEEEEEEEECSSSEEEEEEEEECSSSCCEECSCC----
T ss_pred             EEEEEeeeEECCCCCEEEEEEEeeeecCeEEEccccCCC
Confidence            9999999999999999999999   99999999987663
>3pgz_A Single-stranded DNA-binding protein; ssgcid, single-strand binding protein, structural genomics center for infectious disease; 2.10A {Bartonella henselae} Back     alignment and structure
>3tqy_A Single-stranded DNA-binding protein; DNA replication, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3lgj_A Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Back     alignment and structure
>3afp_A Single-stranded DNA-binding protein; OB-fold, quaternary structure and stability, changes on oligomerisation, water-bridges, DNA damage; 2.05A {Mycobacterium leprae} PDB: 3afq_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A 1x3e_A 1x3f_A 1x3g_A 3a5u_A* Back     alignment and structure
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural GENO joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Back     alignment and structure
>3ulp_A Single-strand binding protein; OB-fold, DNA binding, single-stranded DNA, apicoplast, DNA B protein-DNA complex; HET: DNA; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Back     alignment and structure
>3vdy_A SSB, single-stranded DNA-binding protein SSBB; OB fold; 2.80A {Bacillus subtilis} Back     alignment and structure
>3ull_A DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 PDB: 1s3o_A* 2dud_A Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>4dam_A Single-stranded DNA-binding protein 1; OB-fold; 1.70A {Streptomyces coelicolor} Back     alignment and structure
>3koj_A Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>3k7u_C MP18 RNA editing complex protein; OB-fold, RNA-editing proteins, kinetoplastids, system, RNA binding protein; 2.10A {Trypanosoma brucei} PDB: 3k80_D 3stb_D Back     alignment and structure
>1v1q_A Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} SCOP: b.40.4.3 PDB: 2ccz_A Back     alignment and structure
>3k81_C MP18 RNA editing complex protein; krepa6, single domain antibody, immune system, RNA BIND protein; 3.40A {Trypanosoma brucei} Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A 4apv_A Back     alignment and structure
>4dni_A Fusion protein of RNA-editing complex proteins MP MP18; krepa3, krepa6, editosome, protein/RNA binding, protein BIND binding protein; 2.55A {Trypanosoma brucei} Back     alignment and structure
>3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>4gs3_A Single-stranded DNA-binding protein; primosome, oligonucleotide/oligosaccharide binding domain, D binding protein; 1.09A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>3en2_A Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Back     alignment and structure
>3stb_C RNA-editing complex protein MP42; editosome, nanobody, single domain antibody, VH krepa3, krepa6, RNA binding protein-immune system complex; 2.50A {Trypanosoma brucei} Back     alignment and structure
>4dni_A Fusion protein of RNA-editing complex proteins MP MP18; krepa3, krepa6, editosome, protein/RNA binding, protein BIND binding protein; 2.55A {Trypanosoma brucei} Back     alignment and structure
>4dka_C RNA-editing complex protein MP81; krepa1, VHH, single domain antibody, protein binding, RNA BI protein-immune system complex; 1.97A {Trypanosoma brucei} PDB: 4dk3_C 4dk6_C Back     alignment and structure
>3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Back     alignment and structure
>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2hql_A Hypothetical protein Mg376 homolog; structural genomics, conserved hypothetical protein, GI:1673959, MPN554, OB fold; 2.00A {Mycoplasma pneumoniae} Back     alignment and structure
>1ynx_A Replication factor-A protein 1; canonical OB fold, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C, DNA polymerase III; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>2k75_A Uncharacterized protein TA0387; closed beta barrel, OB fold, structural genomics, PSI-2, protein structure initiative; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 Back     alignment and structure
>3au7_A TIAS, putative uncharacterized protein; ATP hydrolysis, RNA binding protein; 2.60A {Archaeoglobus fulgidus} PDB: 3amt_A* 3amu_A* Back     alignment and structure
>1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A Back     alignment and structure
>2wkd_A ORF34P2; SSB, single-stranded DNA binding, DNA binding protein; 2.10A {Lactococcus phage P2} PDB: 2wkc_A Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Back     alignment and structure
>4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold, transferase; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>4gop_B Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>3kf8_A Protein STN1; OB fold; 2.40A {Candida tropicalis mya-3404} Back     alignment and structure
>1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>3ebe_A Protein MCM10 homolog; OB-fold, zinc finger, CCCH, DNA replication, metal-binding, zinc-finger, replication; 2.30A {Xenopus laevis} PDB: 3h15_A Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d1se8a_231 b.40.4.3 (A:) ssDNA-binding protein {Deinococcus r 8e-41
d1se8a_231 b.40.4.3 (A:) ssDNA-binding protein {Deinococcus r 7e-35
d1qvca_145 b.40.4.3 (A:) ssDNA-binding protein {Escherichia c 2e-35
d1ue1a_118 b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium 1e-32
d1v1qa_111 b.40.4.3 (A:) Primosomal replication protein N, Pr 4e-30
d3ulla_115 b.40.4.3 (A:) ssDNA-binding protein {Human (Homo s 5e-28
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Length = 231 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: ssDNA-binding protein
species: Deinococcus radiodurans [TaxId: 1299]

 Score =  135 bits (340), Expect = 8e-41
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 2/130 (1%)

Query: 3   SVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKL 62
            +N V +IG L RDPE RY  NG AV   ++A  +     + G +R L  +HR++   K 
Sbjct: 2   GMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGND-GRERNLPWYHRVSILGKP 60

Query: 63  AQIV-KQYLKKGSQIYIEGRLQTRKWTNKEGVEKYITEVIADNMQMLGSRKNTNEKNISN 121
           A+   ++ LK G  + +EG L+ R+W   EG ++    V A  M+ LG++    +     
Sbjct: 61  AEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRMEQLGTQPELIQDAGGG 120

Query: 122 NLENNFFNIM 131
              +   N +
Sbjct: 121 VRMSGAMNEV 130
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Length = 231 Back     information, alignment and structure
>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Length = 111 Back     information, alignment and structure
>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d1qvca_145 ssDNA-binding protein {Escherichia coli [TaxId: 56 100.0
d3ulla_115 ssDNA-binding protein {Human (Homo sapiens), mitoc 100.0
d1ue1a_118 ssDNA-binding protein {Mycobacterium tuberculosis 100.0
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [Ta 99.97
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [Ta 99.97
d1v1qa_111 Primosomal replication protein N, PriB {Escherichi 99.96
d1jmca1116 Replication protein A 70 KDa subunit (RPA70) {Huma 97.22
d1o7ia_115 Archaeal ssDNA-binding protein {Archaeon Sulfolobu 95.51
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 93.96
d1jmca2122 Replication protein A 70 KDa subunit (RPA70) {Huma 91.38
d1b8aa1103 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 90.98
d1ltla_239 DNA replication initiator (cdc21/cdc54) N-terminal 89.25
d1c0aa1106 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 88.06
d1wjja_145 Hypothetical protein At4g28440 (F20O9.120) {Thale 84.91
d1l0wa1104 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 84.79
d1e1oa1143 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 81.94
>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: ssDNA-binding protein
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=9e-36  Score=215.89  Aligned_cols=111  Identities=59%  Similarity=1.113  Sum_probs=103.7

Q ss_pred             CccEEEEEEEeCCCCeEEEecCCcEEEEEEEEEecccccCCCCeeeeeceEEEEEEEhHHHHHHHHHcCCCCEEEEEeEe
Q psy14498          3 SVNKVIIIGNLGRDPETRYMSNGDAVTNVSIATTENWRDKNSGEKRELTEWHRITFYRKLAQIVKQYLKKGSQIYIEGRL   82 (171)
Q Consensus         3 ~~N~v~l~G~l~~dp~~~~~~~g~~~~~~~la~~~~~~~~~~G~~~~~~~~~~v~~~g~~A~~~~~~l~kG~~V~V~G~l   82 (171)
                      +||+|+|+|||++||++|++++|+.+++|+||+++++++..+|++.+.++||+|++||++|+.+.++|+||++|+|+|+|
T Consensus         4 ~mN~v~LiG~l~~dpe~r~~~~G~~v~~f~va~~~~~~~~~~~~~~~~t~w~~v~~~g~~Ae~~~~~l~KG~~V~V~G~l   83 (145)
T d1qvca_           4 GVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQL   83 (145)
T ss_dssp             CEEEEEEEEEESSCCEEECCSSSCCEEEEEEEECCCCSCCSSSSCCCCCEEEEEEEETHHHHHHHHHCCTTCEEEEEEEE
T ss_pred             cceEEEEEEECCCCCEEEECCCCCEEEEEEEEecccccccccccccccceEEeeEEecchhhhHhhhcccCCEEEEEEEE
Confidence            79999999999999999999999999999999999998877678888999999999999999999999999999999999


Q ss_pred             eeeeeecCCCcEEEEEEEEEe---EEEEccCCCC
Q psy14498         83 QTRKWTNKEGVEKYITEVIAD---NMQMLGSRKN  113 (171)
Q Consensus        83 ~~~~~~~kdG~~~~~~~i~a~---~i~~l~~~~~  113 (171)
                      +++.|+++||++++.++|+|+   .|.+|.++..
T Consensus        84 ~~~~~~~kdG~~r~~~ei~~~~~~~l~~l~~r~~  117 (145)
T d1qvca_          84 RTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQG  117 (145)
T ss_dssp             EEEEECSSSSCEEEEEEEECTTCEEEECCCCSCC
T ss_pred             EEeeeECCCCCEEEEEEEEEecCCcEEECcCccC
Confidence            999999999999999999997   6677766543
>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmca2 b.40.4.3 (A:299-420) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjja_ b.40.4.3 (A:) Hypothetical protein At4g28440 (F20O9.120) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure