Diaphorina citri psyllid: psy14499

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--

MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL

cccHHHHHHHccccccccEECcccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccccccccccccEEECcccccccHHHHHHHHHcccEEEccEEEccccEEEHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NAD-specific glutamate dehydrogenase		confident	Q5HHC7
Glutamate dehydrogenase 2		confident	Q38946
NAD-specific glutamate dehydrogenase		confident	Q7A6H8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0004352 [MF]	glutamate dehydrogenase (NAD+) activity	probable	GO:0003824, GO:0016491, GO:0003674, GO:0016638, GO:0016639
GO:0006536 [BP]	glutamate metabolic process	probable	GO:0043648, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044238, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0009064, GO:0043436, GO:1901605
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0050897 [MF]	cobalt ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005507 [MF]	copper ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AOG, chain A
Confidence level:very confident
Coverage over the Query: 1-262
View the alignment between query and template
View the model in PyMOL