Psyllid ID: psy14499

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
cccHHHHHHHccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccccHHHHHHHHHcccEEEccEEEccccEEEHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc
cccHHHHHHHHccccccHHcccccHHHccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHcccEcccccccEEccHHHHHcccccEEEEccccccEcHHHHccccccEEEccccccEcHHHHHHHHHHccEEEcHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc
mswmmdtystkknytipgivtgkpisiggsfgrqkatgrgvFIIGSKIASKINLNIINskisiqgfgnVGSVAANLFFKAGAKIVAiqddkttiynpngfnipklqKYVTFTRSikdfnegekindskefwsipcdilipaaiedqitinnaNNVTAKIILegangpttteaddilrdkgiilapdvitnaGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
mswmmdtystkknytipgivtgkpisIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDkttiynpngfnipklqkYVTFTRSIKDFnegekindskefWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGskiaskinlniinskisiQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
*******YSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQ*******
MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
********STKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query262 2.2.26 [Sep-21-2011]
Q7A1B9414 NAD-specific glutamate de yes N/A 0.988 0.625 0.459 1e-63
Q6GAW8414 NAD-specific glutamate de yes N/A 0.988 0.625 0.459 1e-63
Q6GID0414 NAD-specific glutamate de yes N/A 0.988 0.625 0.459 1e-63
Q7A6H8414 NAD-specific glutamate de yes N/A 0.988 0.625 0.459 1e-63
Q99VD0414 NAD-specific glutamate de yes N/A 0.988 0.625 0.459 1e-63
Q5HHC7414 NAD-specific glutamate de yes N/A 0.988 0.625 0.459 1e-63
P39633424 Catabolic NAD-specific gl yes N/A 0.984 0.608 0.427 2e-60
P96110416 Glutamate dehydrogenase O yes N/A 0.996 0.627 0.425 3e-60
P54386428 NADP-specific glutamate d N/A N/A 0.992 0.607 0.433 1e-59
P50735427 Cryptic catabolic NAD-spe no N/A 0.984 0.604 0.435 6e-59
>sp|Q7A1B9|DHE2_STAAW NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=gluD PE=3 SV=1 Back     alignment and function desciption
 Score =  243 bits (619), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 120/261 (45%), Positives = 169/261 (64%), Gaps = 2/261 (0%)

Query: 1   MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSK 60
           M+WMMD YS    +  PG +TGKPI +GGS GR ++T  GV I   + A + N+ I  +K
Sbjct: 154 MAWMMDEYSALDKFNSPGFITGKPIVLGGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAK 213

Query: 61  ISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNE 120
           + IQGFGN GS  A   +  GAKIV I D    +++PNG +I  L        ++ +  E
Sbjct: 214 VVIQGFGNAGSFLAKFLYDLGAKIVGISDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFE 273

Query: 121 GEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKG 180
            E I++ KE + + CDIL+PAAI +QIT +NA+++ A I++E ANGPTT EA  IL ++G
Sbjct: 274 -ETISN-KELFELDCDILVPAAISNQITEDNAHDIKASIVVEAANGPTTPEATRILTERG 331

Query: 181 IILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVS 240
           I+L PDV+ +AGGV VSYFEWVQN     W+E+E+N +L   +  AFD I+EL+  +K+ 
Sbjct: 332 ILLVPDVLASAGGVTVSYFEWVQNNQGYYWSEEEVNEKLREKLEAAFDTIYELSQNRKID 391

Query: 241 LRTAAFIIGCTRVLQAHKTRG 261
           +R AA+IIG  R  +A + RG
Sbjct: 392 MRLAAYIIGIKRTAEAARYRG 412

Staphylococcus aureus (strain MW2) (taxid: 196620)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 2
>sp|Q6GAW8|DHE2_STAAS NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=gluD PE=3 SV=1 Back     alignment and function description
>sp|Q6GID0|DHE2_STAAR NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=gluD PE=3 SV=1 Back     alignment and function description
>sp|Q7A6H8|DHE2_STAAN NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=gluD PE=1 SV=1 Back     alignment and function description
>sp|Q99VD0|DHE2_STAAM NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gluD PE=1 SV=1 Back     alignment and function description
>sp|Q5HHC7|DHE2_STAAC NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=gluD PE=3 SV=1 Back     alignment and function description
>sp|P39633|DHE2_BACSU Catabolic NAD-specific glutamate dehydrogenase RocG OS=Bacillus subtilis (strain 168) GN=rocG PE=1 SV=3 Back     alignment and function description
>sp|P96110|DHE3_THEMA Glutamate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gdhA PE=1 SV=4 Back     alignment and function description
>sp|P54386|DHE4_SYNY3 NADP-specific glutamate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gdhA PE=3 SV=1 Back     alignment and function description
>sp|P50735|GUDB_BACSU Cryptic catabolic NAD-specific glutamate dehydrogenase GudB OS=Bacillus subtilis (strain 168) GN=gudB PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
300313152 430 glutamate dehydrogenase [Herbaspirillum 1.0 0.609 0.614 8e-95
409407629 430 glutamate dehydrogenase [Herbaspirillum 1.0 0.609 0.614 3e-94
415948934 422 Glutamate dehydrogenase [Herbaspirillum 1.0 0.620 0.606 5e-94
399018371 432 glutamate dehydrogenase/leucine dehydrog 1.0 0.606 0.587 4e-92
398835356 430 glutamate dehydrogenase/leucine dehydrog 1.0 0.609 0.599 6e-92
340789164 428 NAD-specific glutamate dehydrogenase [Co 1.0 0.612 0.595 2e-91
374365042 435 Glu/Leu/Phe/Val dehydrogenase [Cupriavid 0.992 0.597 0.572 9e-90
113866500 435 glutamate dehydrogenase [Ralstonia eutro 0.992 0.597 0.572 2e-89
339324646 435 glutamate dehydrogenase [Cupriavidus nec 0.992 0.597 0.572 6e-89
73540162 435 Glu/Leu/Phe/Val dehydrogenase [Ralstonia 0.992 0.597 0.572 7e-89
>gi|300313152|ref|YP_003777244.1| glutamate dehydrogenase [Herbaspirillum seropedicae SmR1] gi|300075937|gb|ADJ65336.1| glutamate dehydrogenase (NAD(P)+) protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
 Score =  352 bits (903), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 204/262 (77%)

Query: 1   MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSK 60
           M+WMMDTYS  +  T  G+VTGKPIS+GGS GR +ATGRGVF++G + A+K  L+I ++K
Sbjct: 167 MAWMMDTYSMNQGSTSSGVVTGKPISLGGSLGRHEATGRGVFVVGCEAAAKRGLDIKDAK 226

Query: 61  ISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNE 120
           +++QGFGNVG +AA LF +AG+K+VA+QD  TT++N  G ++P LQ YV    S+K F  
Sbjct: 227 VAVQGFGNVGGIAARLFAEAGSKVVAVQDHVTTVFNAGGLDVPALQAYVAKNGSVKGFAG 286

Query: 121 GEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKG 180
            ++I D  +FWS+ CDIL+PAA+E QIT  NAN + AKIILEGANGPTT  ADDILRDKG
Sbjct: 287 ADEITDRAQFWSVDCDILVPAALEQQITEANANQIKAKIILEGANGPTTPAADDILRDKG 346

Query: 181 IILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVS 240
           +++ PDVI NAGGV VSYFEWVQ+ S+  WTE EINLRL  I+  AF A+W+LA+ KKVS
Sbjct: 347 VLIVPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINLRLTRIMREAFAAVWQLADEKKVS 406

Query: 241 LRTAAFIIGCTRVLQAHKTRGL 262
           LRTAAFI+ CTRVLQA + RGL
Sbjct: 407 LRTAAFIVACTRVLQAREMRGL 428

Source: Herbaspirillum seropedicae SmR1

Species: Herbaspirillum seropedicae

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|409407629|ref|ZP_11256080.1| glutamate dehydrogenase [Herbaspirillum sp. GW103] gi|386433380|gb|EIJ46206.1| glutamate dehydrogenase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|415948934|ref|ZP_11556803.1| Glutamate dehydrogenase [Herbaspirillum frisingense GSF30] gi|407757827|gb|EKF67743.1| Glutamate dehydrogenase [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|399018371|ref|ZP_10720551.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. CF444] gi|398101616|gb|EJL91828.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|398835356|ref|ZP_10592719.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. YR522] gi|398216346|gb|EJN02894.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|340789164|ref|YP_004754629.1| NAD-specific glutamate dehydrogenase [Collimonas fungivorans Ter331] gi|48428786|gb|AAT42434.1| glutamate dehydrogenase [Collimonas fungivorans Ter331] gi|340554431|gb|AEK63806.1| NAD-specific glutamate dehydrogenase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|374365042|ref|ZP_09623138.1| Glu/Leu/Phe/Val dehydrogenase [Cupriavidus basilensis OR16] gi|373103414|gb|EHP44439.1| Glu/Leu/Phe/Val dehydrogenase [Cupriavidus basilensis OR16] Back     alignment and taxonomy information
>gi|113866500|ref|YP_724989.1| glutamate dehydrogenase [Ralstonia eutropha H16] gi|113525276|emb|CAJ91621.1| glutamate dehydrogenase [Ralstonia eutropha H16] Back     alignment and taxonomy information
>gi|339324646|ref|YP_004684339.1| glutamate dehydrogenase [Cupriavidus necator N-1] gi|338164803|gb|AEI75858.1| glutamate dehydrogenase GdhA [Cupriavidus necator N-1] Back     alignment and taxonomy information
>gi|73540162|ref|YP_294682.1| Glu/Leu/Phe/Val dehydrogenase [Ralstonia eutropha JMP134] gi|72117575|gb|AAZ59838.1| Glu/Leu/Phe/Val dehydrogenase, C terminal:Glu/Leu/Phe/Val dehydrogenase, dimerization region [Ralstonia eutropha JMP134] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
TIGR_CMR|BA_1511428 BA_1511 "glutamate dehydrogena 0.984 0.602 0.454 1.7e-57
UNIPROTKB|Q5HHC7414 gluD "NAD-specific glutamate d 0.988 0.625 0.440 2.1e-54
UNIPROTKB|Q6GAW8414 gluD "NAD-specific glutamate d 0.988 0.625 0.440 2.1e-54
UNIPROTKB|Q6GID0414 gluD "NAD-specific glutamate d 0.988 0.625 0.440 2.1e-54
UNIPROTKB|Q7A1B9414 gluD "NAD-specific glutamate d 0.988 0.625 0.440 2.1e-54
UNIPROTKB|Q7A6H8414 gluD "NAD-specific glutamate d 0.988 0.625 0.440 2.1e-54
UNIPROTKB|Q99VD0414 gluD "NAD-specific glutamate d 0.988 0.625 0.440 2.1e-54
UNIPROTKB|P50735427 gudB "Cryptic catabolic NAD-sp 0.984 0.604 0.427 4.3e-54
TAIR|locus:2183379411 GDH2 "glutamate dehydrogenase 0.988 0.630 0.432 3.8e-53
UNIPROTKB|P39633424 rocG "Catabolic NAD-specific g 0.984 0.608 0.412 1e-52
TIGR_CMR|BA_1511 BA_1511 "glutamate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
 Score = 591 (213.1 bits), Expect = 1.7e-57, P = 1.7e-57
 Identities = 119/262 (45%), Positives = 164/262 (62%)

Query:     1 MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGXXXXXXXXXXXXXXX 60
             M+WMMD YS    +  PG +TGKP+ +GGS GR+ AT +GV I                 
Sbjct:   168 MAWMMDEYSRIDEFNSPGFITGKPLVLGGSHGRETATAKGVTICIREAAKKRDIDIKGAR 227

Query:    61 XXXQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKL-QKYVTFTRSIKDFN 119
                QGFGN GS  A     AGAK++AI D    +++PNG +I  L  +  +F    K FN
Sbjct:   228 VVVQGFGNAGSFLAKFMHDAGAKVIAISDAYGALHDPNGLDIDYLLDRRDSFGTVTKLFN 287

Query:   120 EGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDK 179
                 I++ KE   + CDIL+PAAIE+QIT  NAN++ AKI++E ANGPTT EA  IL D+
Sbjct:   288 N--TISN-KELLELDCDILVPAAIENQITEENANDIKAKIVVEAANGPTTLEATKILTDR 344

Query:   180 GIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKV 239
             GI+L PDV+ +AGGV VSYFEWVQN     WTE+E+  RL  ++  +FD+I+E A  +KV
Sbjct:   345 GILLVPDVLASAGGVTVSYFEWVQNNQGYYWTEEEVEQRLEKVMVRSFDSIYETAQVRKV 404

Query:   240 SLRTAAFIIGCTRVLQAHKTRG 261
             ++R AA+++G  ++ +A + RG
Sbjct:   405 NMRLAAYMVGVRKMAEASRFRG 426
GO:0004353 "glutamate dehydrogenase [NAD(P)+
GO:0006537 "glutamate biosynthetic process" evidence=ISS
UNIPROTKB|Q5HHC7 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus COL (taxid:93062)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GAW8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MSSA476 (taxid:282459)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GID0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MRSA252 (taxid:282458)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A1B9 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MW2 (taxid:196620)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A6H8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus N315 (taxid:158879)] Back     alignment and assigned GO terms
UNIPROTKB|Q99VD0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus Mu50 (taxid:158878)] Back     alignment and assigned GO terms
UNIPROTKB|P50735 gudB "Cryptic catabolic NAD-specific glutamate dehydrogenase GudB" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
TAIR|locus:2183379 GDH2 "glutamate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P39633 rocG "Catabolic NAD-specific glutamate dehydrogenase RocG" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P96110DHE3_THEMA1, ., 4, ., 1, ., 30.42580.99610.6274yesN/A
Q6GID0DHE2_STAAR1, ., 4, ., 1, ., 20.45970.98850.6256yesN/A
Q9YC65DHE3_AERPE1, ., 4, ., 1, ., 30.40370.99230.6220yesN/A
P39633DHE2_BACSU1, ., 4, ., 1, ., 20.42740.98470.6084yesN/A
Q7A1B9DHE2_STAAW1, ., 4, ., 1, ., 20.45970.98850.6256yesN/A
Q5HHC7DHE2_STAAC1, ., 4, ., 1, ., 20.45970.98850.6256yesN/A
P27346DHE2_CLODI1, ., 4, ., 1, ., 20.39840.99230.6175yesN/A
Q47950DHE3_PYRAB1, ., 4, ., 1, ., 30.43770.99230.6190yesN/A
Q7A6H8DHE2_STAAN1, ., 4, ., 1, ., 20.45970.98850.6256yesN/A
O59650DHE3_PYRKO1, ., 4, ., 1, ., 30.41320.97320.6057yesN/A
P80319DHE3_PYRFU1, ., 4, ., 1, ., 30.44150.99230.6190yesN/A
P0CL72DHE3_PYRHR1, ., 4, ., 1, ., 30.44150.99230.6190yesN/A
P0CL73DHE3_PYRHO1, ., 4, ., 1, ., 30.44150.99230.6190yesN/A
Q38946DHE2_ARATH1, ., 4, ., 1, ., 30.44060.98850.6301yesN/A
Q6GAW8DHE2_STAAS1, ., 4, ., 1, ., 20.45970.98850.6256yesN/A
Q99VD0DHE2_STAAM1, ., 4, ., 1, ., 20.45970.98850.6256yesN/A
P80053DHE2_SULSO1, ., 4, ., 1, ., 30.37870.99610.6214yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
COG0334411 COG0334, GdhA, Glutamate dehydrogenase/leucine deh 1e-106
cd01076227 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain 1e-102
PLN02477410 PLN02477, PLN02477, glutamate dehydrogenase 2e-96
pfam00208237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl 4e-95
cd05211217 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding 4e-55
PTZ00079454 PTZ00079, PTZ00079, NADP-specific glutamate dehydr 8e-41
smart00839102 smart00839, ELFV_dehydrog, Glutamate/Leucine/Pheny 1e-39
cd05313254 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain 1e-37
PRK09414445 PRK09414, PRK09414, glutamate dehydrogenase; Provi 1e-36
PRK14031444 PRK14031, PRK14031, glutamate dehydrogenase; Provi 6e-29
PRK14030445 PRK14030, PRK14030, glutamate dehydrogenase; Provi 1e-26
cd01075200 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d 6e-16
PTZ003241002 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Pro 1e-06
COG2902 1592 COG2902, COG2902, NAD-specific glutamate dehydroge 5e-04
>gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  313 bits (803), Expect = e-106
 Identities = 119/262 (45%), Positives = 173/262 (66%), Gaps = 1/262 (0%)

Query: 1   MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSK 60
           M+WMMD YS     + PG+ TGKP+ +GGS GR +ATG GVF    +    +  ++  ++
Sbjct: 150 MAWMMDEYSKIVGNSAPGVFTGKPLELGGSLGRSEATGYGVFYAIREALKALGDDLEGAR 209

Query: 61  ISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNE 120
           +++QGFGNVG  AA    + GAK+VA+ D K  IY+ +G ++  L +      S+ ++  
Sbjct: 210 VAVQGFGNVGQYAAEKLHELGAKVVAVSDSKGGIYDEDGLDVEALLELKERRGSVAEYAG 269

Query: 121 GEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKG 180
            E I  ++E   + CDILIP A+E+ IT +NA+ + AKI++EGANGPTT EAD+IL ++G
Sbjct: 270 AEYI-TNEELLEVDCDILIPCALENVITEDNADQLKAKIVVEGANGPTTPEADEILLERG 328

Query: 181 IILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVS 240
           I++ PD++ NAGGVIVSY EWVQN   L WTE+E++ +L  I+ NAF+A+++ A    V 
Sbjct: 329 ILVVPDILANAGGVIVSYLEWVQNAQGLYWTEEEVDEKLERIMVNAFEAVYQAAKEYGVD 388

Query: 241 LRTAAFIIGCTRVLQAHKTRGL 262
           LRTAA+I+   RV  A K RG 
Sbjct: 389 LRTAAYILAFERVADAMKARGW 410

Length = 411
>gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>gnl|CDD|178095 PLN02477, PLN02477, glutamate dehydrogenase Back     alignment and domain information
>gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|214847 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>gnl|CDD|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|240359 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>gnl|CDD|225455 COG2902, COG2902, NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 262
PLN02477410 glutamate dehydrogenase 100.0
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 100.0
PRK14030445 glutamate dehydrogenase; Provisional 100.0
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 100.0
PRK09414445 glutamate dehydrogenase; Provisional 100.0
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 100.0
PRK14031444 glutamate dehydrogenase; Provisional 100.0
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 100.0
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 100.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 100.0
KOG2250|consensus514 100.0
PTZ003241002 glutamate dehydrogenase 2; Provisional 100.0
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 100.0
smart00839102 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Vali 99.96
COG2902 1592 NAD-specific glutamate dehydrogenase [Amino acid t 99.66
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 99.56
PRK06392 326 homoserine dehydrogenase; Provisional 99.51
PRK08374 336 homoserine dehydrogenase; Provisional 99.48
PRK06270 341 homoserine dehydrogenase; Provisional 99.35
PRK06813 346 homoserine dehydrogenase; Validated 99.07
PLN02700 377 homoserine dehydrogenase family protein 98.88
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.84
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 98.82
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.81
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 98.68
COG0281432 SfcA Malic enzyme [Energy production and conversio 98.68
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 98.63
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 98.6
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 98.56
PRK12861 764 malic enzyme; Reviewed 98.49
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.48
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 98.48
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 98.48
PRK12862 763 malic enzyme; Reviewed 98.41
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 98.4
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.4
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.36
PRK13529563 malate dehydrogenase; Provisional 98.35
PLN03129581 NADP-dependent malic enzyme; Provisional 98.31
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.22
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 98.21
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 98.21
PTZ00075476 Adenosylhomocysteinase; Provisional 98.2
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.16
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 98.13
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 98.12
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.1
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.09
PLN02928347 oxidoreductase family protein 98.08
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.06
PLN02494477 adenosylhomocysteinase 98.04
PRK07574385 formate dehydrogenase; Provisional 98.04
PTZ00317559 NADP-dependent malic enzyme; Provisional 98.04
PRK12549284 shikimate 5-dehydrogenase; Reviewed 98.03
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.0
PLN03139386 formate dehydrogenase; Provisional 97.96
PRK13243333 glyoxylate reductase; Reviewed 97.95
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 97.94
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.93
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.92
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.9
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 97.88
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.88
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.82
PRK06932314 glycerate dehydrogenase; Provisional 97.79
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 97.79
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.78
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 97.77
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.75
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.74
PRK06436303 glycerate dehydrogenase; Provisional 97.74
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 97.73
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.73
PRK06349 426 homoserine dehydrogenase; Provisional 97.72
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.71
PRK12480330 D-lactate dehydrogenase; Provisional 97.7
PRK06487317 glycerate dehydrogenase; Provisional 97.63
PRK00048257 dihydrodipicolinate reductase; Provisional 97.63
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.62
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.62
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.62
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 97.61
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.59
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.57
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 97.55
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.51
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 97.49
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 97.49
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 97.49
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 97.47
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.44
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.44
PLN00203519 glutamyl-tRNA reductase 97.43
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.41
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.38
PLN02306386 hydroxypyruvate reductase 97.34
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.33
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.32
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.32
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 97.28
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 97.28
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.28
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.27
PRK13940414 glutamyl-tRNA reductase; Provisional 97.25
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.24
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.22
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.21
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.2
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 97.19
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.17
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.11
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 97.09
COG5322351 Predicted dehydrogenase [General function predicti 97.09
PRK08605332 D-lactate dehydrogenase; Validated 97.07
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 97.05
PRK12550272 shikimate 5-dehydrogenase; Reviewed 97.05
KOG1370|consensus434 97.02
KOG0068|consensus406 97.0
TIGR00036266 dapB dihydrodipicolinate reductase. 96.98
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.98
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.96
PRK03659601 glutathione-regulated potassium-efflux system prot 96.95
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.95
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 96.93
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 96.93
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.9
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.89
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.86
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.85
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 96.84
PRK13303265 L-aspartate dehydrogenase; Provisional 96.84
PRK15059292 tartronate semialdehyde reductase; Provisional 96.83
PRK07417279 arogenate dehydrogenase; Reviewed 96.82
PRK06141314 ornithine cyclodeaminase; Validated 96.81
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.81
PRK13403 335 ketol-acid reductoisomerase; Provisional 96.74
PRK07680273 late competence protein ComER; Validated 96.73
PRK14982340 acyl-ACP reductase; Provisional 96.73
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.69
PRK03562621 glutathione-regulated potassium-efflux system prot 96.68
PRK07340304 ornithine cyclodeaminase; Validated 96.67
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.62
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.57
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.55
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.54
PRK08328231 hypothetical protein; Provisional 96.51
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.51
PRK11579 346 putative oxidoreductase; Provisional 96.48
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.48
KOG0069|consensus336 96.47
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 96.47
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.45
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.44
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.44
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.43
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.42
PRK06046326 alanine dehydrogenase; Validated 96.37
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.35
PRK08300302 acetaldehyde dehydrogenase; Validated 96.35
PRK08223287 hypothetical protein; Validated 96.35
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.35
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.33
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.31
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 96.28
PLN02858 1378 fructose-bisphosphate aldolase 96.27
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.27
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.23
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.22
KOG1257|consensus582 96.21
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.2
PLN02688266 pyrroline-5-carboxylate reductase 96.2
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 96.18
PRK05479 330 ketol-acid reductoisomerase; Provisional 96.17
PLN02858 1378 fructose-bisphosphate aldolase 96.15
PRK09496453 trkA potassium transporter peripheral membrane com 96.14
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.13
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.12
COG0673 342 MviM Predicted dehydrogenases and related proteins 96.12
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.11
PRK08618325 ornithine cyclodeaminase; Validated 96.11
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.1
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.09
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.07
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.05
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 96.02
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 96.02
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.01
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 95.99
PRK10669558 putative cation:proton antiport protein; Provision 95.99
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 95.98
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.97
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.96
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 95.95
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 95.92
PLN02712 667 arogenate dehydrogenase 95.9
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 95.88
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.87
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.87
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.85
PRK15116268 sulfur acceptor protein CsdL; Provisional 95.84
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.84
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.77
PRK06153393 hypothetical protein; Provisional 95.77
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.75
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 95.73
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.72
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.72
KOG0409|consensus 327 95.67
PRK04148134 hypothetical protein; Provisional 95.67
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.65
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 95.65
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 95.61
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 95.61
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.59
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.59
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 95.59
PRK14851 679 hypothetical protein; Provisional 95.57
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.56
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.54
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 95.51
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 95.46
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 95.46
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.46
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.46
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.42
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 95.42
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 95.42
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.41
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.39
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 95.39
PLN02256304 arogenate dehydrogenase 95.39
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.37
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.34
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.34
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.33
PRK08291330 ectoine utilization protein EutC; Validated 95.33
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 95.32
KOG2380|consensus 480 95.3
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 95.29
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 95.29
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 95.27
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.26
KOG0455|consensus 364 95.22
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.22
PRK06719157 precorrin-2 dehydrogenase; Validated 95.21
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 95.2
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.2
PRK07411 390 hypothetical protein; Validated 95.2
PRK09496 453 trkA potassium transporter peripheral membrane com 95.16
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 95.16
PRK14852 989 hypothetical protein; Provisional 95.16
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.16
PRK06823315 ornithine cyclodeaminase; Validated 95.14
PRK08655 437 prephenate dehydrogenase; Provisional 95.14
PRK07877 722 hypothetical protein; Provisional 95.14
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.13
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 95.08
COG2344211 AT-rich DNA-binding protein [General function pred 95.08
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 95.07
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 95.06
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 95.05
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.05
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 95.04
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 95.03
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.02
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.02
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 94.99
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 94.96
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 94.91
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 94.85
PRK06545 359 prephenate dehydrogenase; Validated 94.84
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.78
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 94.77
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 94.76
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 94.73
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.72
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.71
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.7
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.6
PLN02712 667 arogenate dehydrogenase 94.57
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 94.57
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.56
PRK07589346 ornithine cyclodeaminase; Validated 94.56
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.56
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 94.55
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 94.54
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 94.53
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 94.51
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.51
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 94.46
PRK06407301 ornithine cyclodeaminase; Provisional 94.39
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 94.36
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.36
PRK10206 344 putative oxidoreductase; Provisional 94.36
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 94.3
PRK08507275 prephenate dehydrogenase; Validated 94.28
KOG2741|consensus 351 94.27
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.23
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.22
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.14
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 94.14
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.1
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.09
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.09
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 94.05
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 94.02
KOG2018|consensus 430 94.01
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 93.9
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.88
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 93.84
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 93.76
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 93.73
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 93.71
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 93.57
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.55
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 93.52
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 93.5
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 93.45
PRK09880343 L-idonate 5-dehydrogenase; Provisional 93.45
PLN02775286 Probable dihydrodipicolinate reductase 93.41
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 93.34
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.23
PTZ00431260 pyrroline carboxylate reductase; Provisional 93.21
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 93.19
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 92.92
PRK11730 715 fadB multifunctional fatty acid oxidation complex 92.69
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 92.68
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 92.68
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 92.62
PTZ00082 321 L-lactate dehydrogenase; Provisional 92.57
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.53
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.44
PRK05225 487 ketol-acid reductoisomerase; Validated 92.42
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 92.41
COG2130340 Putative NADP-dependent oxidoreductases [General f 92.39
COG0300265 DltE Short-chain dehydrogenases of various substra 92.38
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 92.35
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 92.34
cd01486 307 Apg7 Apg7 is an E1-like protein, that activates tw 92.32
PRK10537393 voltage-gated potassium channel; Provisional 92.27
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 92.26
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 92.19
KOG2336|consensus 422 92.17
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 92.1
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 91.92
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 91.76
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 91.54
PRK06849 389 hypothetical protein; Provisional 91.53
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.4
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 91.26
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 91.22
PRK08339263 short chain dehydrogenase; Provisional 91.18
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.1
PRK06196315 oxidoreductase; Provisional 91.06
PLN02353 473 probable UDP-glucose 6-dehydrogenase 91.06
PRK05717255 oxidoreductase; Validated 90.97
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 90.83
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.69
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.61
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 90.48
PRK07060245 short chain dehydrogenase; Provisional 90.44
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 90.41
PRK07523255 gluconate 5-dehydrogenase; Provisional 90.34
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.33
PTZ00117 319 malate dehydrogenase; Provisional 90.21
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.04
PRK07236 386 hypothetical protein; Provisional 90.02
PRK08192338 aspartate carbamoyltransferase; Provisional 89.96
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.93
cd01489 312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 89.89
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 89.84
PRK06125259 short chain dehydrogenase; Provisional 89.84
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 89.83
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 89.77
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 89.74
PRK05867253 short chain dehydrogenase; Provisional 89.67
PRK11891429 aspartate carbamoyltransferase; Provisional 89.65
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.51
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 89.39
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.34
PRK05872296 short chain dehydrogenase; Provisional 89.31
KOG1207|consensus245 89.16
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 89.08
PRK05876275 short chain dehydrogenase; Provisional 89.05
PRK09291257 short chain dehydrogenase; Provisional 89.04
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 89.04
PRK08818 370 prephenate dehydrogenase; Provisional 89.03
PRK06949258 short chain dehydrogenase; Provisional 88.99
PLN02896 353 cinnamyl-alcohol dehydrogenase 88.97
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 88.91
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 88.85
PRK08628258 short chain dehydrogenase; Provisional 88.77
PRK07825273 short chain dehydrogenase; Provisional 88.75
PRK07062265 short chain dehydrogenase; Provisional 88.73
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 88.7
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 88.63
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 88.6
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 88.6
KOG0029|consensus 501 88.57
PLN02514357 cinnamyl-alcohol dehydrogenase 88.55
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 88.52
PRK12742237 oxidoreductase; Provisional 88.52
KOG1196|consensus343 88.47
COG3804 350 Uncharacterized conserved protein related to dihyd 88.36
PRK09072263 short chain dehydrogenase; Provisional 88.36
PRK08265261 short chain dehydrogenase; Provisional 88.34
PRK07063260 short chain dehydrogenase; Provisional 88.33
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 88.33
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 88.26
PRK06057255 short chain dehydrogenase; Provisional 88.26
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 88.23
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 88.23
PRK06194287 hypothetical protein; Provisional 88.17
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 88.11
PLN02586360 probable cinnamyl alcohol dehydrogenase 88.08
PRK08013 400 oxidoreductase; Provisional 88.07
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 88.03
PRK05866293 short chain dehydrogenase; Provisional 87.97
PRK08085254 gluconate 5-dehydrogenase; Provisional 87.94
TIGR03628114 arch_S11P archaeal ribosomal protein S11P. This mo 87.92
PRK06223 307 malate dehydrogenase; Reviewed 87.9
PRK10637 457 cysG siroheme synthase; Provisional 87.88
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 87.85
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 87.81
PRK05562223 precorrin-2 dehydrogenase; Provisional 87.8
PRK07774250 short chain dehydrogenase; Provisional 87.79
PF03853169 YjeF_N: YjeF-related protein N-terminus; InterPro: 87.74
PRK07831262 short chain dehydrogenase; Provisional 87.72
PRK06138252 short chain dehydrogenase; Provisional 87.71
PRK06124256 gluconate 5-dehydrogenase; Provisional 87.68
KOG1198|consensus347 87.59
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 87.56
PLN02206 442 UDP-glucuronate decarboxylase 87.55
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 87.5
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 87.47
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 87.46
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.43
PRK06172253 short chain dehydrogenase; Provisional 87.37
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 87.36
PRK12829264 short chain dehydrogenase; Provisional 87.35
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 87.33
PRK06184 502 hypothetical protein; Provisional 87.25
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 87.24
PRK14804311 ornithine carbamoyltransferase; Provisional 87.23
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.22
PLN02602 350 lactate dehydrogenase 87.22
PRK07890258 short chain dehydrogenase; Provisional 87.21
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 87.12
KOG0024|consensus354 87.0
PRK08263275 short chain dehydrogenase; Provisional 86.99
PRK07576264 short chain dehydrogenase; Provisional 86.99
PRK08862227 short chain dehydrogenase; Provisional 86.95
PRK09186256 flagellin modification protein A; Provisional 86.95
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.93
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 86.93
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 86.85
PRK07067257 sorbitol dehydrogenase; Provisional 86.8
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 86.74
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 86.7
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 86.63
PRK07035252 short chain dehydrogenase; Provisional 86.63
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 86.62
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 86.61
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 86.6
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 86.57
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 86.51
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 86.46
PRK12828239 short chain dehydrogenase; Provisional 86.45
PRK07478254 short chain dehydrogenase; Provisional 86.43
PLN02240 352 UDP-glucose 4-epimerase 86.41
PRK06841255 short chain dehydrogenase; Provisional 86.39
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 86.37
PRK06199379 ornithine cyclodeaminase; Validated 86.3
PRK12833 467 acetyl-CoA carboxylase biotin carboxylase subunit; 86.28
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.24
KOG0023|consensus360 86.22
PRK12939250 short chain dehydrogenase; Provisional 86.21
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 86.21
PRK12938246 acetyacetyl-CoA reductase; Provisional 86.2
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 86.17
CHL00041116 rps11 ribosomal protein S11 86.16
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 86.13
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 86.09
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 86.04
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 86.03
PRK06753 373 hypothetical protein; Provisional 85.95
PRK07814263 short chain dehydrogenase; Provisional 85.94
PRK06567 1028 putative bifunctional glutamate synthase subunit b 85.92
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 85.9
PRK09607132 rps11p 30S ribosomal protein S11P; Reviewed 85.9
PRK08213259 gluconate 5-dehydrogenase; Provisional 85.9
PRK07097265 gluconate 5-dehydrogenase; Provisional 85.81
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 85.81
PRK09126 392 hypothetical protein; Provisional 85.8
PRK08703239 short chain dehydrogenase; Provisional 85.78
PRK01713334 ornithine carbamoyltransferase; Provisional 85.78
PRK06500249 short chain dehydrogenase; Provisional 85.74
PRK06139 330 short chain dehydrogenase; Provisional 85.72
PRK07326237 short chain dehydrogenase; Provisional 85.69
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.66
>PLN02477 glutamate dehydrogenase Back     alignment and domain information 
Probab=100.00  E-value=9.8e-76  Score=552.71  Aligned_cols=260  Identities=45%  Similarity=0.794  Sum_probs=255.4

Q ss_pred             CchhhhHhhhhcCCcCCceEecccCCCCccCCCCChhHHHHHHHHHHHHHHhCCCCCCCeEEEEcCCHHHHHHHHHHHHC
Q psy14499          1 MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKA   80 (262)
Q Consensus         1 m~w~~d~y~~~~g~~~~~~~tGkp~~~GG~~~~~~aTg~Gv~~~~~~~~~~~g~~l~~~~v~IqGfG~VG~~~a~~L~~~   80 (262)
                      |+||+|+|+++.|++ +++|||||+.+|||.+|.++|||||+++++++++++|.+++|+||+||||||||+++|++|.++
T Consensus       150 M~w~~d~y~~~~g~~-~~~vtGkp~~~gGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~VaIqGfGnVG~~~A~~L~e~  228 (410)
T PLN02477        150 MAWILDEYSKFHGFS-PAVVTGKPIDLGGSLGREAATGRGVVFATEALLAEHGKSIAGQTFVIQGFGNVGSWAAQLIHEK  228 (410)
T ss_pred             HHHHHHHHHHhhCCC-CceEeCCCcccCCCCCCCccchHHHHHHHHHHHHHcCCCccCCEEEEECCCHHHHHHHHHHHHc
Confidence            899999999999987 9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEEEeCCCceeeCCCCCCHHHHHHHHHhcCCccCCCCceecCCCccccccCceEEeeCCccCcccccchhccCceEE
Q psy14499         81 GAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKII  160 (262)
Q Consensus        81 g~~vv~V~D~~G~i~~~~GlD~~~l~~~~~~~g~~~~~~~~~~~~~~~~il~~~~DIlipaa~~~~it~e~a~~~~~kiI  160 (262)
                      |++||+|+|++|++|||+|||+++|++++++++++.+|++++.++ +++++..+||||+|||++++||++|+++++||+|
T Consensus       229 GakVVaVsD~~G~iy~~~GLD~~~L~~~k~~~g~l~~~~~a~~i~-~~e~l~~~~DvliP~Al~~~I~~~na~~i~ak~I  307 (410)
T PLN02477        229 GGKIVAVSDITGAVKNENGLDIPALRKHVAEGGGLKGFPGGDPID-PDDILVEPCDVLIPAALGGVINKENAADVKAKFI  307 (410)
T ss_pred             CCEEEEEECCCCeEECCCCCCHHHHHHHHHhcCchhccccceEec-CccceeccccEEeeccccccCCHhHHHHcCCcEE
Confidence            999999999999999999999999999999999999999888888 8899999999999999999999999999999999


Q ss_pred             EecCCCCCCHHHHHHHHHCCCeEeccccccchhhHHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhcCCC
Q psy14499        161 LEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVS  240 (262)
Q Consensus       161 ve~AN~p~t~ea~~~l~~rgi~~iPD~~aN~GGvi~s~~E~~~~~~~~~~~~~~v~~~l~~~~~~~~~~v~~~a~~~~~~  240 (262)
                      +||||+|+||+|+++|++|||+|+||+++|+|||++|||||+||+++++|++++|.++|+++|.++++++++.|++++++
T Consensus       308 ~egAN~p~t~ea~~~L~~rGI~~~PD~~aNaGGVivs~~E~~qn~~~~~w~~~~v~~~l~~~m~~~~~~v~~~a~~~~~~  387 (410)
T PLN02477        308 VEAANHPTDPEADEILRKKGVVVLPDIYANSGGVTVSYFEWVQNIQGFMWEEEKVNRELDRYMTDAFKALKEMCKTHNCS  387 (410)
T ss_pred             EeCCCCCCCHHHHHHHHHCCcEEEChHHhCCCCeeeeHHHhhhccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHcCC
Q psy14499        241 LRTAAFIIGCTRVLQAHKTRGL  262 (262)
Q Consensus       241 ~r~aa~~~a~~rv~~a~~~rg~  262 (262)
                      ||+|||++|++||.++|+.|||
T Consensus       388 ~r~aA~~~a~~rv~~a~~~rG~  409 (410)
T PLN02477        388 LRMGAFTLGVNRVARATVLRGW  409 (410)
T ss_pred             HHHHHHHHHHHHHHHHHHhhCC
Confidence            9999999999999999999997

>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG2250|consensus Back     alignment and domain information
>PTZ00324 glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>smart00839 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>KOG1257|consensus Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0455|consensus Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2336|consensus Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03628 arch_S11P archaeal ribosomal protein S11P Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03853 YjeF_N: YjeF-related protein N-terminus; InterPro: IPR004443 The YjeF N-terminal domains occur either as single proteins or fusions with other domains and are commonly associated with enzymes Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>CHL00041 rps11 ribosomal protein S11 Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK09607 rps11p 30S ribosomal protein S11P; Reviewed Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
3aoe_A424 Crystal Structure Of Hetero-Hexameric Glutamate Deh 1e-75
3aog_A440 Crystal Structure Of Glutamate Dehydrogenase (Gdhb) 2e-75
1b3b_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 1e-58
1b26_A416 Glutamate Dehydrogenase Length = 416 2e-58
2tmg_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 2e-57
3k92_A424 Crystal Structure Of A E93k Mutant Of The Majour Ba 5e-57
3k8z_A423 Crystal Structure Of Gudb1 A Decryptified Secondary 6e-56
1euz_A419 Glutamate Dehydrogenase From Thermococcus Profundus 9e-55
1gtm_A419 Structure Of Glutamate Dehydrogenase Length = 419 1e-54
1bvu_A418 Glutamate Dehydrogenase From Thermococcus Litoralis 3e-52
1v9l_A421 L-Glutamate Dehydrogenase From Pyrobaculum Islandic 4e-45
2yfq_A421 Crystal Structure Of Glutamate Dehydrogenase From P 8e-45
3etd_A501 Structure Of Glutamate Dehydrogenase Complexed With 1e-37
1l1f_A505 Structure Of Human Glutamate Dehydrogenase-Apo Form 1e-37
1nr1_A496 Crystal Structure Of The R463a Mutant Of Human Glut 1e-37
1nqt_A496 Crystal Structure Of Bovine Glutamate Dehydrogenase 1e-37
3mw9_A501 Bovine Glutamate Dehydrogenase Complexed With Nadh, 1e-36
1hwy_A501 Bovine Glutamate Dehydrogenase Complexed With Nad A 2e-35
3aoe_E419 Crystal Structure Of Hetero-Hexameric Glutamate Deh 7e-33
3r3j_A456 Kinetic And Structural Characterization Of Plasmodi 6e-28
2yfh_A448 Structure Of A Chimeric Glutamate Dehydrogenase Len 2e-27
4fcc_A450 Glutamate Dehydrogenase From E. Coli Length = 450 1e-26
3sbo_A447 Structure Of E.Coli Gdh From Native Source Length = 2e-26
2yfg_E447 Structural Determinants Of Cofactor Specificity And 7e-26
1k89_A449 K89l Mutant Of Glutamate Dehydrogenase Length = 449 2e-22
1hrd_A449 Glutamate Dehydrogenase Length = 449 2e-22
1aup_A449 Glutamate Dehydrogenase Length = 449 1e-21
2bma_A470 The Crystal Structure Of Plasmodium Falciparum Glut 8e-21
1c1x_B355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-09
1c1d_B355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-09
1c1x_A355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-09
1bxg_B356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-09
1bw9_B356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-09
1bw9_A356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-09
1c1d_A355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-09
1bxg_A356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-09
3vpx_A364 Crystal Structure Of Leucine Dehydrogenase From A P 3e-04
>pdb|3AOE|A Chain A, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 424 Back     alignment and structure 
Iteration: 1

 Score =  279 bits (713), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 176/262 (67%), Gaps = 1/262 (0%)
Query: 1   MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGXXXXXXXXXXXXXXX 60
           M+WMMDTYS     T+PG+VTGKPI++GGS GR+ ATGRGVFI                 
Sbjct: 162 MAWMMDTYSMNVGRTVPGVVTGKPIALGGSLGRRDATGRGVFITAAAAAEKIGLQVEGAR 221
Query: 61  XXXQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNE 120
              QGFGNVG+ AA  F   GA++VA+QD   T+YN  G +   L ++V     ++ + +
Sbjct: 222 VAIQGFGNVGNAAARAFHDHGARVVAVQDHTGTVYNEAGIDPYDLLRHVQEFGGVRGYPK 281
Query: 121 GEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKG 180
            E +  + +FW +P + L+PAA+E QIT  NA  + A+I+ EGANGPTT  ADDIL +KG
Sbjct: 282 AEPL-PAADFWGLPVEFLVPAALEKQITEQNAWRIRARIVAEGANGPTTPAADDILLEKG 340
Query: 181 IILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVS 240
           +++ PDVI NAGGV VSYFEWVQ+ ++  WTE+EIN RL  ++ NAF+A+W++A  KK+ 
Sbjct: 341 VLVVPDVIANAGGVTVSYFEWVQDFNSYFWTEEEINARLERVLRNAFEAVWQVAQEKKIP 400
Query: 241 LRTAAFIIGCTRVLQAHKTRGL 262
           LRTAA+++  TRVL+A   RGL
Sbjct: 401 LRTAAYVVAATRVLEARALRGL 422
>pdb|3AOG|A Chain A, Crystal Structure Of Glutamate Dehydrogenase (Gdhb) From Thermus Thermophilus (Glu Bound Form) Length = 440 Back     alignment and structure
>pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 Back     alignment and structure
>pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 Back     alignment and structure
>pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 Back     alignment and structure
>pdb|3K92|A Chain A, Crystal Structure Of A E93k Mutant Of The Majour Bacillus Su Glutamate Dehydrogenase Rocg Length = 424 Back     alignment and structure
>pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 Back     alignment and structure
>pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 Back     alignment and structure
>pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 Back     alignment and structure
>pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 Back     alignment and structure
>pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 Back     alignment and structure
>pdb|2YFQ|A Chain A, Crystal Structure Of Glutamate Dehydrogenase From Peptoniphilus Asaccharolyticus Length = 421 Back     alignment and structure
>pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 Back     alignment and structure
>pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 Back     alignment and structure
>pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 Back     alignment and structure
>pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-adp Complex Length = 496 Back     alignment and structure
>pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 Back     alignment and structure
>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And 2-Oxoglutarate Length = 501 Back     alignment and structure
>pdb|3AOE|E Chain E, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 419 Back     alignment and structure
>pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456 Back     alignment and structure
>pdb|2YFH|A Chain A, Structure Of A Chimeric Glutamate Dehydrogenase Length = 448 Back     alignment and structure
>pdb|4FCC|A Chain A, Glutamate Dehydrogenase From E. Coli Length = 450 Back     alignment and structure
>pdb|3SBO|A Chain A, Structure Of E.Coli Gdh From Native Source Length = 447 Back     alignment and structure
>pdb|2YFG|E Chain E, Structural Determinants Of Cofactor Specificity And Domain Flexibility In Bacterial Glutamate Dehydrogenases Length = 447 Back     alignment and structure
>pdb|1K89|A Chain A, K89l Mutant Of Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1HRD|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1AUP|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|2BMA|A Chain A, The Crystal Structure Of Plasmodium Falciparum Glutamate Dehydrogenase, A Putative Target For Novel Antimalarial Drugs Length = 470 Back     alignment and structure
>pdb|1C1X|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1C1D|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|1C1X|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1BXG|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|1BW9|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1BW9|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1C1D|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|1BXG|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|3VPX|A Chain A, Crystal Structure Of Leucine Dehydrogenase From A Psychrophilic Bacterium Sporosarcina Psychrophila. Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 1e-140
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 1e-138
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 1e-137
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 1e-136
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 1e-135
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 1e-135
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 1e-134
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 1e-118
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 2e-93
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 4e-93
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 6e-84
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 7e-80
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 3e-79
2yfg_A447 NADP-specific glutamate dehydrogenase; oxidoreduct 6e-76
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
 Score =  399 bits (1028), Expect = e-140
 Identities = 134/262 (51%), Positives = 187/262 (71%), Gaps = 1/262 (0%)

Query: 1   MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSK 60
           M+WMMDTYS     T+PG+VTGKPI++GGS GR+ ATGRGVFI  +  A KI L +  ++
Sbjct: 178 MAWMMDTYSMNVGRTVPGVVTGKPIALGGSLGRRDATGRGVFITAAAAAEKIGLQVEGAR 237

Query: 61  ISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNE 120
           ++IQGFGNVG+ AA  F   GA++VA+QD   T+YN  G +   L ++V     ++ + +
Sbjct: 238 VAIQGFGNVGNAAARAFHDHGARVVAVQDHTGTVYNEAGIDPYDLLRHVQEFGGVRGYPK 297

Query: 121 GEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKG 180
            E +  + +FW +P + L+PAA+E QIT  NA  + A+I+ EGANGPTT  ADDIL +KG
Sbjct: 298 AEPL-PAADFWGLPVEFLVPAALEKQITEQNAWRIRARIVAEGANGPTTPAADDILLEKG 356

Query: 181 IILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVS 240
           +++ PDVI NAGGV VSYFEWVQ+ ++  WTE+EIN RL  ++ NAF+A+W++A  KK+ 
Sbjct: 357 VLVVPDVIANAGGVTVSYFEWVQDFNSYFWTEEEINARLERVLRNAFEAVWQVAQEKKIP 416

Query: 241 LRTAAFIIGCTRVLQAHKTRGL 262
           LRTAA+++  TRVL+A   RGL
Sbjct: 417 LRTAAYVVAATRVLEARALRGL 438
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 Back     alignment and structure
>2yfg_A NADP-specific glutamate dehydrogenase; oxidoreductase; 2.50A {Escherichia coli} PDB: 3sbo_A 2yfg_E Length = 447 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 100.0
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 100.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 100.0
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 100.0
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 100.0
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 100.0
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 100.0
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 100.0
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 100.0
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 100.0
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 100.0
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 100.0
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 100.0
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 100.0
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 98.8
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.77
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 98.68
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.54
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.53
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.5
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.49
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.48
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 98.47
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.45
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.42
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.42
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 98.4
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.39
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.35
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.31
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.3
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.27
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.26
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 98.25
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 98.23
3l6d_A306 Putative oxidoreductase; structural genomics, prot 98.21
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 98.19
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 98.18
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 98.18
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.18
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.17
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 98.14
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 98.14
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.13
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 98.1
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 98.09
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 98.08
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.08
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 98.07
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.06
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.05
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.04
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.03
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.03
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.02
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.02
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.01
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.99
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.99
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.97
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 97.93
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.93
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.91
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.9
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.89
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.89
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.88
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.88
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.87
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.87
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.87
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.86
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.85
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.84
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.83
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.82
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.81
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.8
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.79
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.78
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.76
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.76
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.75
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.75
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.75
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.74
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.73
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 97.72
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.72
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.69
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.69
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.68
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.67
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.66
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.66
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.65
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.64
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 97.62
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.62
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 97.61
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.6
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.6
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.6
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.6
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.58
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.58
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.58
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.57
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 97.57
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 97.56
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.56
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.56
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.55
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 97.55
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.54
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.54
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.53
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.53
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 97.52
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.52
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.51
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.51
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 97.48
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.48
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.46
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.46
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.45
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.44
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.44
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.44
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.42
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.39
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.39
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 97.37
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.37
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 97.37
4had_A 350 Probable oxidoreductase protein; structural genomi 97.35
4ezb_A317 Uncharacterized conserved protein; structural geno 97.34
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.34
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.34
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.32
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 97.31
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.3
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 97.3
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.3
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.28
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 97.27
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.27
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.26
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.24
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.23
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.23
4h3v_A 390 Oxidoreductase domain protein; structural genomics 97.22
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.2
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 97.2
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.2
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 97.18
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.18
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 97.17
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.16
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 97.16
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 97.16
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.16
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 97.15
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.14
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 97.13
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.11
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.11
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.1
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.1
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.06
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.06
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.06
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.06
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.05
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 97.05
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 97.04
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.03
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.03
1ydw_A 362 AX110P-like protein; structural genomics, protein 97.01
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.01
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 97.01
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.01
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.0
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.0
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 96.98
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.97
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.97
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.97
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.95
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.95
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.94
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.91
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.9
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 96.89
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 96.89
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.89
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.88
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.87
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 96.87
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.86
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 96.81
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.8
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 96.79
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.79
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 96.78
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 96.78
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 96.78
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.76
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 96.76
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.75
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 96.75
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 96.75
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.7
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 96.68
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 96.66
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.64
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.64
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.64
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.63
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 96.63
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.62
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 96.61
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.61
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.6
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 96.6
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 96.6
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 96.58
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.58
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 96.56
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.54
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 96.52
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.52
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.51
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.5
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 96.49
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.48
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.48
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.48
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 96.47
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.46
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.46
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 96.45
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.4
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 96.38
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 96.38
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 96.37
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 96.36
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.34
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.31
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 96.3
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 96.28
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.27
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.25
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 96.22
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.19
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 96.15
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.14
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 96.12
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 96.11
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 96.02
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 96.02
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 95.95
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 95.93
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 95.9
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.9
2d59_A144 Hypothetical protein PH1109; COA binding, structur 95.87
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 95.86
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.8
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 95.8
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.78
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 95.78
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 95.74
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.7
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 95.7
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 95.69
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.69
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 95.65
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 95.55
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.54
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.51
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.48
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.44
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.43
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 95.42
2duw_A145 Putative COA-binding protein; ligand binding prote 95.41
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 95.4
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 95.37
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 95.36
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 95.32
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 95.24
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.23
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 95.19
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 95.18
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 95.12
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 95.08
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 95.02
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 94.99
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 94.99
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 94.95
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 94.92
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 94.9
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.89
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 94.83
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.82
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.78
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 94.75
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 94.69
3v1y_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 94.66
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 94.6
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 94.58
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 94.57
1iuk_A140 Hypothetical protein TT1466; structural genomics, 94.57
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 94.55
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 94.51
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.49
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 94.46
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 94.44
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.39
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.34
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 94.32
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 94.3
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 94.26
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 94.24
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 94.15
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 94.14
4eso_A255 Putative oxidoreductase; NADP, structural genomics 94.12
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 94.08
1lnq_A336 MTHK channels, potassium channel related protein; 94.07
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 94.06
4dqx_A277 Probable oxidoreductase protein; structural genomi 94.04
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 94.01
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 94.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 93.95
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 93.93
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 93.93
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 92.98
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 93.89
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 93.88
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 93.81
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 93.81
3fbg_A346 Putative arginate lyase; structural genomics, unkn 93.81
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 93.79
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 93.79
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 93.75
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 93.74
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 93.73
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 93.73
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 93.71
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 93.7
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 93.67
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 93.61
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 93.59
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 93.57
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 93.55
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 93.5
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 93.5
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 93.5
4eye_A342 Probable oxidoreductase; structural genomics, niai 93.42
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.36
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 93.35
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 93.33
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 93.31
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 93.3
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 93.29
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 93.28
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.28
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 93.23
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 93.18
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 93.13
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 93.12
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 93.11
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 93.1
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 93.1
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 93.08
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 93.07
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 93.03
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 93.0
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 92.97
3ids_C 359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 92.97
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 92.94
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 92.94
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 92.94
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.85
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 92.78
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 92.66
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 92.62
4hb9_A 412 Similarities with probable monooxygenase; flavin, 92.56
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 92.49
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 92.45
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 92.45
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.45
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 92.45
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 92.44
3tl2_A 315 Malate dehydrogenase; center for structural genomi 92.43
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 92.4
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 92.38
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 92.37
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 92.36
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 92.34
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 92.27
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 92.18
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 92.17
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 92.13
3gem_A260 Short chain dehydrogenase; structural genomics, AP 92.13
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 92.05
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 92.03
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 92.03
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.03
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 92.01
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 91.99
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 91.99
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 91.98
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 91.97
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 91.96
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 91.91
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 91.91
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 91.86
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 91.84
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.81
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 91.81
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 91.77
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 91.68
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 91.65
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 91.62
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 91.62
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 91.6
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 91.59
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 91.55
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.54
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 91.51
3gms_A340 Putative NADPH:quinone reductase; structural genom 91.48
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 91.47
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 91.47
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 91.46
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 91.43
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 91.43
1nff_A260 Putative oxidoreductase RV2002; directed evolution 91.36
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 91.35
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 91.35
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.34
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 91.34
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 91.33
3imf_A257 Short chain dehydrogenase; structural genomics, in 91.3
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 91.28
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 91.1
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 91.06
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 91.06
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 91.05
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 91.03
3ius_A286 Uncharacterized conserved protein; APC63810, silic 91.01
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 90.99
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 90.93
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 90.92
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 90.92
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 90.92
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 90.9
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 90.89
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 90.88
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 90.88
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 90.87
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 90.87
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.85
4gx0_A565 TRKA domain protein; membrane protein, ION channel 90.84
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 90.82
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 90.81
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 90.8
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 90.76
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 90.75
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 90.74
3tjr_A301 Short chain dehydrogenase; structural genomics, se 90.74
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 90.7
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 90.67
3tox_A280 Short chain dehydrogenase; structural genomics, PS 90.66
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 90.64
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 90.63
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 90.62
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 90.62
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 90.61
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 90.6
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.55
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 90.55
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 90.55
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 90.5
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 90.46
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 90.41
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 90.4
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 90.37
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 90.36
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 90.33
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 90.26
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 90.22
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 90.21
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 90.2
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 90.18
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 90.17
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 90.13
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 90.1
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 90.07
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
Probab=100.00  E-value=5.2e-75  Score=548.02  Aligned_cols=260  Identities=42%  Similarity=0.778  Sum_probs=254.6

Q ss_pred             CchhhhHhhhhcCCcCCceEecccCCCCccCCCCChhHHHHHHHHHHHHHHhCCCCCCCeEEEEcCCHHHHHHHHHHHHC
Q psy14499          1 MSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKA   80 (262)
Q Consensus         1 m~w~~d~y~~~~g~~~~~~~tGkp~~~GG~~~~~~aTg~Gv~~~~~~~~~~~g~~l~~~~v~IqGfG~VG~~~a~~L~~~   80 (262)
                      |+||+|+|++++|+++++++||||+.+|||.+|.++|||||+++++++++++|.+++++||+||||||||+++|++|.+.
T Consensus       164 m~~~~~~y~~~~g~~~~~~vTGkp~~~GGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~vaVqG~GnVG~~aa~~l~e~  243 (424)
T 3k92_A          164 MAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDA  243 (424)
T ss_dssp             HHHHHHHHHHHHTSCCGGGCSSCCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCGGGCEEEEECCSHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCCCCcceeecccccCCCcCCCcccHHHHHHHHHHHHHHHcCCCcccCEEEEECCCHHHHHHHHHHHHC
Confidence            79999999999999989999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEEEeCCCceeeCCCCCCHHHHHHHHHhcCCccCCCCceecCCCccccccCceEEeeCCccCcccccchhccCceEE
Q psy14499         81 GAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKII  160 (262)
Q Consensus        81 g~~vv~V~D~~G~i~~~~GlD~~~l~~~~~~~g~~~~~~~~~~~~~~~~il~~~~DIlipaa~~~~it~e~a~~~~~kiI  160 (262)
                      |++||+|+|++|++|||+|||+++|++++++++++.+|| ++.++ ++++|+.+||||+|||++++||++|+++++||+|
T Consensus       244 GakVVavsD~~G~iyd~~GlD~~~l~~~~~~~g~i~~~~-a~~~~-~~~i~~~~~DIliPcA~~n~I~~~~a~~l~ak~V  321 (424)
T 3k92_A          244 GAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLF-TDVIT-NEELLEKDCDILVPAAISNQITAKNAHNIQASIV  321 (424)
T ss_dssp             TCEEEEEECSSCEEECTTCCCHHHHHHHCCSSSCCGGGC-SCCBC-HHHHHHSCCSEEEECSCSSCBCTTTGGGCCCSEE
T ss_pred             CCEEEEEECCCCcEECCCCCCHHHHHHHHHHhCCCCCCC-cEEec-CccceeccccEEeecCcccccChhhHhhcCceEE
Confidence            999999999999999999999999999999999999997 67776 7889999999999999999999999999999999


Q ss_pred             EecCCCCCCHHHHHHHHHCCCeEeccccccchhhHHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhcCCC
Q psy14499        161 LEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVS  240 (262)
Q Consensus       161 ve~AN~p~t~ea~~~l~~rgi~~iPD~~aN~GGvi~s~~E~~~~~~~~~~~~~~v~~~l~~~~~~~~~~v~~~a~~~~~~  240 (262)
                      +||||+|+||+|+++|++|||+|+||+++|+|||++||+||+||+++++|++++|.++|+++|.++++++++.|++++++
T Consensus       322 ~EgAN~p~t~eA~~iL~~rGI~~~PD~~aNAGGV~vS~~E~~qn~~~~~w~~eeV~~~l~~~m~~~~~~v~~~a~~~~~~  401 (424)
T 3k92_A          322 VERANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVD  401 (424)
T ss_dssp             ECCSSSCBCHHHHHHHHHTTCEEECHHHHTTHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTCC
T ss_pred             EcCCCCCCCHHHHHHHHHCCCEEECchHhcCCCEEeehhHHHhcccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHhCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHcCC
Q psy14499        241 LRTAAFIIGCTRVLQAHKTRGL  262 (262)
Q Consensus       241 ~r~aa~~~a~~rv~~a~~~rg~  262 (262)
                      +|+|||++|++||+++|+.|||
T Consensus       402 ~~~aA~~~a~~rva~a~~~~G~  423 (424)
T 3k92_A          402 MRLAAYMTGIRKSAEASRFRGW  423 (424)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHcCC
Confidence            9999999999999999999996
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 262
d1bgva1255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 5e-65
d1b26a1234 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Therm 2e-63
d1gtma1239 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archa 8e-62
d1hwxa1293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 5e-60
d1v9la1242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 1e-59
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 4e-52
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 2e-36
d1b26a2175 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermo 1e-06
d1v9la2176 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyroba 3e-06
d1hwxa2208 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (B 4e-06
d1gtma2178 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archae 2e-05
d1bgva2194 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostr 4e-04
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 0.004
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]

 Score =  201 bits (512), Expect = 5e-65
 Identities = 72/253 (28%), Positives = 116/253 (45%), Gaps = 13/253 (5%)

Query: 23  KPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGA 82
           K  S GGS  R +ATG G       +    N  ++   +++ GFGNV   AA    + GA
Sbjct: 1   KARSFGGSLVRPEATGYGSVYYVEAVMKHENDTLVGKTVALAGFGNVAWGAAKKLAELGA 60

Query: 83  KIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKD-------FNEGEKINDSKEFWSIPC 135
           K V +      IY+P G    +   Y+   R+             G +    ++ W    
Sbjct: 61  KAVTLSGPDGYIYDPEGITTEEKINYMLEMRASGRNKVQDYADKFGVQFFPGEKPWGQKV 120

Query: 136 DILIPAAIEDQITINNANNVTA---KIILEGANGPTTTEADDIL-RDKGIILAPDVITNA 191
           DI++P A ++ + +  A  + A   K  +E AN PTT EA   L +   +++AP    NA
Sbjct: 121 DIIMPCATQNDVDLEQAKKIVANNVKYYIEVANMPTTNEALRFLMQQPNMVVAPSKAVNA 180

Query: 192 GGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKV--SLRTAAFIIG 249
           GGV+VS FE  QN   L WT +E++ +L+ ++ +  D     A    +  +L   A I+G
Sbjct: 181 GGVLVSGFEMSQNSERLSWTAEEVDSKLHQVMTDIHDGSAAAAERYGLGYNLVAGANIVG 240

Query: 250 CTRVLQAHKTRGL 262
             ++  A   +G+
Sbjct: 241 FQKIADAMMAQGI 253
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 239 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 175 Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 176 Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 208 Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 178 Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 194 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.81
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.66
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.63
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 98.63
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.25
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 98.23
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 98.2
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 98.13
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.12
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 98.11
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.09
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.05
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.05
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 97.99
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.98
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.98
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.95
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.94
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.93
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 97.88
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.87
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.85
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 97.85
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.84
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.81
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.81
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.79
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.78
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.76
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.75
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.62
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.56
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.53
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.47
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.45
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.44
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.35
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.35
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.34
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.34
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.31
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.26
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.22
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.21
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 97.14
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.12
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.12
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.05
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.04
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.04
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.98
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.97
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.93
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.93
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.9
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.83
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.81
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.79
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.76
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.68
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.63
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.6
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.47
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.46
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 96.45
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.44
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.44
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.37
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.36
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.35
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.29
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.25
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.18
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.13
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.12
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.11
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.11
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.1
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.09
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.08
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.07
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.03
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.97
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.97
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.92
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.88
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.83
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.8
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.79
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 95.73
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.7
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.7
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.63
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.53
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.38
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 95.32
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.29
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.24
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.23
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.23
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.17
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.1
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.05
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.05
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.01
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.99
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.97
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 94.96
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 94.91
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 94.89
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.89
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.86
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.86
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 94.85
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.84
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 94.79
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.72
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.7
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.7
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.68
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.66
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.64
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.59
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 94.59
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 94.58
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 94.56
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.56
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 94.51
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 94.5
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.45
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 94.44
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.43
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 94.23
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 94.21
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 94.09
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.09
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.08
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 94.08
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 94.03
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 93.94
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 93.85
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 93.85
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 93.76
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.75
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 93.75
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 93.74
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.74
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.71
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.66
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 93.65
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.65
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.64
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 93.57
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 93.49
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 93.4
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 93.39
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 93.25
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.25
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 93.14
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.13
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 93.11
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 93.09
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 93.07
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 93.07
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 93.0
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 93.0
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.92
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 92.92
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.88
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.86
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 92.78
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 92.73
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 92.67
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.55
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 92.52
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.46
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 92.41
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 92.32
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 92.21
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 92.16
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.96
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 91.93
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 91.93
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 91.89
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 91.81
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 91.78
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 91.7
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.58
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.58
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 91.56
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 91.48
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 91.38
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.35
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 91.29
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 91.18
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 91.18
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.14
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.01
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 90.97
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 90.96
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 90.95
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 90.95
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 90.88
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 90.86
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.68
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 90.51
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 90.44
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 90.33
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.16
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.15
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 90.05
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 89.98
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.97
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 89.95
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 89.78
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 89.65
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 89.59
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 89.56
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 89.53
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 89.41
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 89.4
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.25
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.24
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 89.1
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 89.1
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.03
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 88.79
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 88.76
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 88.71
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 88.56
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 88.03
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 87.99
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 87.74
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 87.5
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 87.41
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 87.4
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 87.36
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 87.24
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 87.23
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 87.22
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 87.07
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 86.97
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 86.9
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.88
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 86.58
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 86.47
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 86.46
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 86.45
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 86.39
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 86.35
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 86.26
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 85.83
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 85.83
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 85.83
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 85.55
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 85.52
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 85.33
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 85.3
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 85.23
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 85.19
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 85.08
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 84.81
d2uubk1119 Ribosomal protein S11 {Thermus thermophilus [TaxId 84.79
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 84.67
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 84.37
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 84.23
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 84.18
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 84.18
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 84.15
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 84.07
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 83.73
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 83.72
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 83.56
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 83.53
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 83.39
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 83.39
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 83.09
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 83.05
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 83.0
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 82.92
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 82.75
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 82.47
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 82.27
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.05
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 81.82
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 81.4
d2qalk1117 Ribosomal protein S11 {Escherichia coli [TaxId: 56 81.13
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.91
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 80.85
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 80.82
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 80.72
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 80.53
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 80.5
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 80.49
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 80.36
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 80.32
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 80.07
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]

Probab=100.00  E-value=2e-69  Score=479.67  Aligned_cols=239  Identities=29%  Similarity=0.479  Sum_probs=223.9

Q ss_pred             ccCCCCccCCCCChhHHHHHHHHHHHHHHhCCCCCCCeEEEEcCCHHHHHHHHHHHHCCCEEEEEeCCCceeeCCCCCCH
Q psy14499         23 KPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNI  102 (262)
Q Consensus        23 kp~~~GG~~~~~~aTg~Gv~~~~~~~~~~~g~~l~~~~v~IqGfG~VG~~~a~~L~~~g~~vv~V~D~~G~i~~~~GlD~  102 (262)
                      ||.++|||.+|.++|||||++++++++++++.+|+++||+||||||||++++++|.+.|++||+|+|++|++|||+|||+
T Consensus         1 Kp~~~GGs~gR~eATG~Gv~~~~~~~~~~~~~~l~g~~v~IQGfGnVG~~~a~~L~e~GakvvavsD~~G~i~~~~Gld~   80 (255)
T d1bgva1           1 KARSFGGSLVRPEATGYGSVYYVEAVMKHENDTLVGKTVALAGFGNVAWGAAKKLAELGAKAVTLSGPDGYIYDPEGITT   80 (255)
T ss_dssp             CCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCSTTCEEEECCSSHHHHHHHHHHHHHTCEEEEEEETTEEEECTTCSCS
T ss_pred             CCccccCCCCCCccchHHHHHHHHHHHHhCCCCCCCCEEEEECCCHHHHHHHHHHHHcCCeEEEEecCCceEecCCCCCH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHh-----cCCccCCC---CceecCCCccccccCceEEeeCCccCcccccchhccC---ceEEEecCCCCCCHH
Q psy14499        103 PKLQKYVTF-----TRSIKDFN---EGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVT---AKIILEGANGPTTTE  171 (262)
Q Consensus       103 ~~l~~~~~~-----~g~~~~~~---~~~~~~~~~~il~~~~DIlipaa~~~~it~e~a~~~~---~kiIve~AN~p~t~e  171 (262)
                      ++++++..+     .+++.+|+   +.+.++ ++++|+.+||||+|||.++.||.+++++++   ||+|+||||+|+||+
T Consensus        81 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~DiliPcA~~~~I~~~~a~~l~a~~ck~I~EgAN~p~t~e  159 (255)
T d1bgva1          81 EEKINYMLEMRASGRNKVQDYADKFGVQFFP-GEKPWGQKVDIIMPCATQNDVDLEQAKKIVANNVKYYIEVANMPTTNE  159 (255)
T ss_dssp             HHHHHHHHHHHHHCCCCTHHHHHHHTCEEEE-TCCGGGSCCSEEECCSCTTCBCHHHHHHHHHTTCCEEECCSSSCBCHH
T ss_pred             HHHHHHHHHHhhhcCcchhhhhhhcCceeec-hhhcccccccEEeeccccccccHHHHHhhhhcCceEEecCCCCCcchH
Confidence            999887653     33444442   445666 889999999999999999999999999995   899999999999999


Q ss_pred             HHHH-HHHCCCeEeccccccchhhHHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhcCC--CHHHHHHHH
Q psy14499        172 ADDI-LRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKV--SLRTAAFII  248 (262)
Q Consensus       172 a~~~-l~~rgi~~iPD~~aN~GGvi~s~~E~~~~~~~~~~~~~~v~~~l~~~~~~~~~~v~~~a~~~~~--~~r~aa~~~  248 (262)
                      |++. |++|||+|+||+++|+|||++|||||+||++++.|++++|.++|+++|.++++++++.++++++  ++|+|||++
T Consensus       160 a~~~ll~~~gI~vvPD~laNaGGVivSy~E~~qn~~~~~w~~~ev~~~l~~~m~~~~~~v~~~a~~~~~~~~lr~aA~~~  239 (255)
T d1bgva1         160 ALRFLMQQPNMVVAPSKAVNAGGVLVSGFEMSQNSERLSWTAEEVDSKLHQVMTDIHDGSAAAAERYGLGYNLVAGANIV  239 (255)
T ss_dssp             HHHHHHHCTTCEEECHHHHTTHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSCHHHHHHHH
T ss_pred             HHHHHHHhcCCEEehHhhhcCCceeeehhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHH
Confidence            9876 5679999999999999999999999999999999999999999999999999999999999998  799999999


Q ss_pred             HHHHHHHHHHHcCC
Q psy14499        249 GCTRVLQAHKTRGL  262 (262)
Q Consensus       249 a~~rv~~a~~~rg~  262 (262)
                      |++||+++|+.||+
T Consensus       240 a~~Rva~A~~~rG~  253 (255)
T d1bgva1         240 GFQKIADAMMAQGI  253 (255)
T ss_dssp             HHHHHHHHHHHHCS
T ss_pred             HHHHHHHHHHHcCC
Confidence            99999999999996
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2qalk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure