Diaphorina citri psyllid: psy14509

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---

MSPGCTTTIGVNTQLFLLFPVMTESDVKKPLPNGPQEGVNYPISVLYCGNCSLPVEYCEYHPEYEKCKVWLEKNLPEEFEKLVKLSGDGGDEDATEEKKRQKRGGKGIVKARKKEEVPKQRGGKGIVKARKKEEVPKQVCVSRAPRGKKKSVTVVTGLSSFDIDLKVASKFFGTRFACGSSVTGDDEIVIQGDVKDDLFDVIPEKWPEIDEDFIEDLGDLKSPTYNIGKLCFTYTYYYFMGSA

cccccccccccccHHHHcccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHccHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHcccccccccccHHHccccccccEEEEEEEECcccccEEEEEccccccccHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHHHHccccccccEEEccccccccccccccEEEEEEEEEEccc

****CTTTIGVNTQLFLLFPVMTE************EGVNYPISVLYCGNCSLPVEYCEYHPEYEKCKVWLEKNLPEEFEKLVK*********************************************************SRAPRGKKKSVTVVTGLSSFDIDLKVASKFFGTRFACGSSVTGDDEIVIQGDVKDDLFDVIPEKWPEIDEDFIEDLGDLKSPTYNIGKLCFTYTYYYFMGSA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Density-regulated protein	May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon.	confident	Q6DFN7
Density-regulated protein	May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon.	confident	Q2HJ47
Density-regulated protein	May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon.	confident	Q5ZJ39

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003743 [MF]	translation initiation factor activity	probable	GO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IF1, chain A
Confidence level:confident
Coverage over the Query: 134-218
View the alignment between query and template
View the model in PyMOL