Diaphorina citri psyllid: psy14512


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MFASAAAASPESSSPLPIEAPKGAESAVNPEKKLKPCCACPETKKVRDACQREKEDRIGESQPFQEQTLSHQDKVYPGRTLSHQDKVRPGQKSNPQPSAYKADALPTKLTRLV
cccccccccccccccccccccccccccccccccccccccccccHHHHcHHHHccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccc
*************************************CACPETKKVRDACQR*********************KVYPG*************************ALPTKLTRL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFASAAAASPESSSPLPIEAPKGAESAVNPEKKLKPCCACPETKKVRDACQREKEDRIGESQPFQEQTLSHQDKVYPGRTLSHQDKVRPGQKSNPQPSAYKADALPTKLTRLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006825 [BP]copper ion transportprobableGO:0006810, GO:0006812, GO:0006811, GO:0000041, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0006091 [BP]generation of precursor metabolites and energyprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0046688 [BP]response to copper ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0016531 [MF]copper chaperone activityprobableGO:0043169, GO:0046872, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0016530, GO:0005507
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0Y, chain B
Confidence level:very confident
Coverage over the Query: 57-72
View the alignment between query and template
View the model in PyMOL