Diaphorina citri psyllid: psy14513

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MTSKQNSGSRQDISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNHVPY
cccccccccccccccccccccccccccccccccccccccHHHHcccccccEEcccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
************ISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSKQNSGSRQDISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNHVPY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0005488 [MF]bindingprobableGO:0003674
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0051246 [BP]regulation of protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0050789
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0016020 [CC]membraneprobableGO:0005575
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0048589 [BP]developmental growthprobableGO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 31-123
View the alignment between query and template
View the model in PyMOL
Template: 2V70, chain A
Confidence level:very confident
Coverage over the Query: 13-162
View the alignment between query and template
View the model in PyMOL