Psyllid ID: psy14513


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MTSKQNSGSRQDISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNHVPY
cccccccccccccccccccccccccccccccccccccccHHHHcccccccEEcccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cccccccccHHHccccccEEEEEEEcccccccccEEEEcHHHHcccccccEEEEcccccccEccHHHHcccccccEEEEcccccccccHHHcccccccEEEccccccccccHHHHHHHHHHHHccccccccccccccccHHHcccccccccHHHccccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
mtskqnsgsrqdisydtqYTIMKVqlpystansELYAIRKNTFKNLLNLQTLycnfnpkltfihpysfnndwslkefyinnnaitslphelgdwdslevldiqsnpwtcdcsIQWLIDYVAKRqrtdpelnynlhcsqpvkfsnvhllsnpllshisgecvKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYkyarnhvpy
mtskqnsgsrqdisydtqYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNHVPY
MTSKQNSGSRQDISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKlypllfimtlllitlvvylICMSYKYARNHVPY
*************SYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYAR*****
************ISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNH***
************ISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNHVPY
*****NSGSRQDISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNHVPY
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSKQNSGSRQDISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGALVISQLSTQFYKLYPLLFIMTLLLITLVVYLICMSYKYARNHVPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
A1KZ92 1463 Peroxidasin-like protein yes N/A 0.397 0.056 0.352 3e-10
Q9WVB4 1523 Slit homolog 3 protein OS yes N/A 0.555 0.076 0.319 3e-09
A4IGL7 1457 Peroxidasin OS=Xenopus tr no N/A 0.401 0.057 0.372 4e-08
Q3UQ28 1475 Peroxidasin homolog OS=Mu no N/A 0.406 0.057 0.356 5e-08
O94813 1529 Slit homolog 2 protein OS no N/A 0.555 0.075 0.303 7e-08
Q9R1B9 1521 Slit homolog 2 protein OS no N/A 0.555 0.076 0.303 8e-08
Q92626 1479 Peroxidasin homolog OS=Ho no N/A 0.406 0.057 0.356 8e-08
O75325 713 Leucine-rich repeat neuro no N/A 0.392 0.115 0.349 1e-07
Q9H3W5 708 Leucine-rich repeat neuro no N/A 0.507 0.149 0.309 2e-07
Q6UXK5 716 Leucine-rich repeat neuro no N/A 0.598 0.174 0.269 2e-07
>sp|A1KZ92|PXDNL_HUMAN Peroxidasin-like protein OS=Homo sapiens GN=PXDNL PE=1 SV=3 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)

Query: 33  SELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPH-EL 91
           +E++A+ K TFK L++L+ LY +FN +L  + P +F +   L+  +++NN ++ +P    
Sbjct: 108 NEIHALDKQTFKGLISLEHLYIHFN-QLEMLQPETFGDLLRLERLFLHNNKLSKIPAGSF 166

Query: 92  GDWDSLEVLDIQSNPWTCDCSIQWL 116
            + DSL+ L + SN   CDC + WL
Sbjct: 167 SNLDSLKRLRLDSNALVCDCDLMWL 191





Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 7
>sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 Back     alignment and function description
>sp|A4IGL7|PXDN_XENTR Peroxidasin OS=Xenopus tropicalis GN=pxdn PE=2 SV=1 Back     alignment and function description
>sp|Q3UQ28|PXDN_MOUSE Peroxidasin homolog OS=Mus musculus GN=Pxdn PE=2 SV=2 Back     alignment and function description
>sp|O94813|SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens GN=SLIT2 PE=1 SV=1 Back     alignment and function description
>sp|Q9R1B9|SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus GN=Slit2 PE=2 SV=2 Back     alignment and function description
>sp|Q92626|PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens GN=PXDN PE=1 SV=2 Back     alignment and function description
>sp|O75325|LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens GN=LRRN2 PE=2 SV=2 Back     alignment and function description
>sp|Q9H3W5|LRRN3_HUMAN Leucine-rich repeat neuronal protein 3 OS=Homo sapiens GN=LRRN3 PE=2 SV=1 Back     alignment and function description
>sp|Q6UXK5|LRRN1_HUMAN Leucine-rich repeat neuronal protein 1 OS=Homo sapiens GN=LRRN1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
346470385 459 hypothetical protein [Amblyomma maculatu 0.641 0.291 0.299 3e-14
427789513 459 Putative secreted protein [Rhipicephalus 0.794 0.361 0.269 1e-13
158300127 472 AGAP012425-PA [Anopheles gambiae str. PE 0.555 0.245 0.328 6e-13
157127989 494 leucine-rich transmembrane protein [Aede 0.545 0.230 0.309 9e-13
346467745 389 hypothetical protein [Amblyomma maculatu 0.583 0.313 0.296 2e-12
321466875 562 hypothetical protein DAPPUDRAFT_305325 [ 0.502 0.186 0.366 2e-12
442752727 463 Putative secreted protein [Ixodes ricinu 0.894 0.403 0.26 5e-12
241747129 463 secreted protein, putative [Ixodes scapu 0.856 0.386 0.265 3e-11
157127987 512 leucine-rich transmembrane protein [Aede 0.550 0.224 0.291 6e-11
241603653 391 leucine-rich transmembrane protein, puta 0.425 0.227 0.340 2e-09
>gi|346470385|gb|AEO35037.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 71/147 (48%), Gaps = 13/147 (8%)

Query: 13  ISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFN--- 69
           + Y++   +  ++  Y     EL A+  + F +   ++ L+ + NPKL  I    F    
Sbjct: 240 LGYNSFMRLESIEELYLENMGELEAVEGDAFAHQKKMRALFLDSNPKLESIDLDIFGIFW 299

Query: 70  -----NDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQ 124
                 +W+L+E Y+ NN I  L  ++  W   E+LD+Q NPW CDC+  W+     ++ 
Sbjct: 300 RVETAANWTLRELYLQNNKIKYLDEDIAPWKQFEILDLQGNPWACDCNNAWI-----RKL 354

Query: 125 RTDPELNYNLHCSQPVKFSNVHLLSNP 151
              PEL  NL C  P KF +  +L  P
Sbjct: 355 PLQPELTANLRCDSPSKFEHKPMLELP 381




Source: Amblyomma maculatum

Species: Amblyomma maculatum

Genus: Amblyomma

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|427789513|gb|JAA60208.1| Putative secreted protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|158300127|ref|XP_320129.3| AGAP012425-PA [Anopheles gambiae str. PEST] gi|157013008|gb|EAA00711.3| AGAP012425-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157127989|ref|XP_001661262.1| leucine-rich transmembrane protein [Aedes aegypti] gi|108882322|gb|EAT46547.1| AAEL002307-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|346467745|gb|AEO33717.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|321466875|gb|EFX77868.1| hypothetical protein DAPPUDRAFT_305325 [Daphnia pulex] Back     alignment and taxonomy information
>gi|442752727|gb|JAA68523.1| Putative secreted protein [Ixodes ricinus] Back     alignment and taxonomy information
>gi|241747129|ref|XP_002405614.1| secreted protein, putative [Ixodes scapularis] gi|215505884|gb|EEC15378.1| secreted protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|157127987|ref|XP_001661261.1| leucine-rich transmembrane protein [Aedes aegypti] gi|108882321|gb|EAT46546.1| AAEL002295-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|241603653|ref|XP_002405709.1| leucine-rich transmembrane protein, putative [Ixodes scapularis] gi|215502558|gb|EEC12052.1| leucine-rich transmembrane protein, putative [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
UNIPROTKB|A1KZ92 1463 PXDNL "Peroxidasin-like protei 0.397 0.056 0.352 5e-10
MGI|MGI:1315202 1523 Slit3 "slit homolog 3 (Drosoph 0.555 0.076 0.319 5.2e-10
UNIPROTKB|F1RR92 1340 SLIT3 "Uncharacterized protein 0.555 0.086 0.327 9.4e-10
UNIPROTKB|O75094 1523 SLIT3 "Slit homolog 3 protein" 0.555 0.076 0.319 1.4e-09
RGD|69311 1523 Slit3 "slit homolog 3 (Drosoph 0.555 0.076 0.311 1.4e-09
UNIPROTKB|O88280 1523 Slit3 "Slit homolog 3 protein" 0.555 0.076 0.311 1.4e-09
UNIPROTKB|J3KNP3 1530 SLIT3 "Slit homolog 3 protein" 0.555 0.075 0.319 1.4e-09
UNIPROTKB|Q6UXK5 716 LRRN1 "Leucine-rich repeat neu 0.593 0.173 0.271 1.4e-09
UNIPROTKB|F1PKU2 1429 PXDNL "Uncharacterized protein 0.397 0.058 0.341 2.1e-09
UNIPROTKB|P22792545 CPN2 "Carboxypeptidase N subun 0.449 0.172 0.346 3.3e-09
UNIPROTKB|A1KZ92 PXDNL "Peroxidasin-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 158 (60.7 bits), Expect = 5.0e-10, P = 5.0e-10
 Identities = 30/85 (35%), Positives = 53/85 (62%)

Query:    33 SELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPH-EL 91
             +E++A+ K TFK L++L+ LY +FN +L  + P +F +   L+  +++NN ++ +P    
Sbjct:   108 NEIHALDKQTFKGLISLEHLYIHFN-QLEMLQPETFGDLLRLERLFLHNNKLSKIPAGSF 166

Query:    92 GDWDSLEVLDIQSNPWTCDCSIQWL 116
              + DSL+ L + SN   CDC + WL
Sbjct:   167 SNLDSLKRLRLDSNALVCDCDLMWL 191




GO:0004519 "endonuclease activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0004601 "peroxidase activity" evidence=ISS
GO:0042744 "hydrogen peroxide catabolic process" evidence=ISS
GO:0020037 "heme binding" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=ISS
GO:0005615 "extracellular space" evidence=ISS
MGI|MGI:1315202 Slit3 "slit homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR92 SLIT3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O75094 SLIT3 "Slit homolog 3 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|69311 Slit3 "slit homolog 3 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O88280 Slit3 "Slit homolog 3 protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNP3 SLIT3 "Slit homolog 3 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UXK5 LRRN1 "Leucine-rich repeat neuronal protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKU2 PXDNL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P22792 CPN2 "Carboxypeptidase N subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
smart0008251 smart00082, LRRCT, Leucine rich repeat C-terminal 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
TIGR00864 2740 TIGR00864, PCC, polycystin cation channel protein 0.004
>gnl|CDD|214507 smart00082, LRRCT, Leucine rich repeat C-terminal domain Back     alignment and domain information
 Score = 39.0 bits (91), Expect = 6e-05
 Identities = 11/50 (22%), Positives = 20/50 (40%), Gaps = 2/50 (4%)

Query: 105 NPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLS 154
           NP+ CDC ++WL+ ++   +        +L C+ P       L       
Sbjct: 1   NPFICDCELRWLLRWLQANEHLQD--PVDLRCASPSSLRGPLLELLHSEF 48


Length = 51

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|188093 TIGR00864, PCC, polycystin cation channel protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG4237|consensus498 99.81
KOG4194|consensus 873 99.66
KOG4237|consensus 498 99.56
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 99.23
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.17
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.16
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.13
PLN03150623 hypothetical protein; Provisional 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.74
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 98.71
KOG0444|consensus 1255 98.63
PLN03150623 hypothetical protein; Provisional 98.58
KOG4194|consensus 873 98.55
KOG0472|consensus 565 98.41
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.3
KOG0617|consensus264 98.28
KOG0444|consensus 1255 98.26
KOG0472|consensus565 98.14
KOG0618|consensus 1081 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.0
KOG0618|consensus 1081 97.99
KOG0532|consensus 722 97.94
KOG1644|consensus233 97.92
KOG0617|consensus264 97.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.78
KOG1259|consensus490 97.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.71
KOG1859|consensus 1096 97.65
KOG1259|consensus490 97.51
KOG4579|consensus177 97.43
KOG4579|consensus177 97.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.03
KOG0532|consensus 722 96.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.77
KOG0531|consensus 414 96.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.67
KOG1644|consensus233 96.6
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 96.46
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.32
KOG4658|consensus 889 96.3
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.12
smart0037026 LRR Leucine-rich repeats, outliers. 96.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.95
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.94
KOG1859|consensus 1096 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.86
KOG3207|consensus505 95.75
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.59
KOG0531|consensus 414 95.56
KOG2739|consensus260 95.55
KOG3207|consensus505 95.46
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.44
KOG2123|consensus 388 94.34
PF0146325 LRRCT: Leucine rich repeat C-terminal domain; Inte 94.32
smart0037026 LRR Leucine-rich repeats, outliers. 93.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.89
KOG2982|consensus 418 93.65
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 92.66
KOG4658|consensus 889 91.25
KOG0473|consensus 326 90.47
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 90.42
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.38
KOG3665|consensus 699 89.09
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.75
PF0539394 Hum_adeno_E3A: Human adenovirus early E3A glycopro 88.24
KOG2982|consensus 418 87.91
KOG1909|consensus382 86.57
PRK15386 426 type III secretion protein GogB; Provisional 86.53
KOG2123|consensus 388 86.15
KOG2739|consensus260 85.99
KOG3665|consensus 699 85.22
PF05568 189 ASFV_J13L: African swine fever virus J13L protein; 82.6
PF06679163 DUF1180: Protein of unknown function (DUF1180); In 80.04
>KOG4237|consensus Back     alignment and domain information
Probab=99.81  E-value=2.3e-20  Score=153.21  Aligned_cols=140  Identities=23%  Similarity=0.366  Sum_probs=121.4

Q ss_pred             CcccccceeccccccccccccccCchhhcCCcccceecccccccccccCccccCCCCCcCEEeccCCcCcccCCCC-CCC
Q psy14513         16 DTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHEL-GDW   94 (209)
Q Consensus        16 ~~~~~l~~L~ll~~~s~n~l~~l~~~~f~~l~~L~~L~Ls~n~~l~~i~~~~f~~l~~L~~L~Ls~N~l~~l~~~~-~~l   94 (209)
                      ..|..|++|..+ .+++|.|+.|.+++|.++..+++|+|..| +|+.+...+|.++..|+.|+|.+|+++.+.+.. ..+
T Consensus       268 ~cf~~L~~L~~l-nlsnN~i~~i~~~aFe~~a~l~eL~L~~N-~l~~v~~~~f~~ls~L~tL~L~~N~it~~~~~aF~~~  345 (498)
T KOG4237|consen  268 KCFKKLPNLRKL-NLSNNKITRIEDGAFEGAAELQELYLTRN-KLEFVSSGMFQGLSGLKTLSLYDNQITTVAPGAFQTL  345 (498)
T ss_pred             HHHhhcccceEe-ccCCCccchhhhhhhcchhhhhhhhcCcc-hHHHHHHHhhhccccceeeeecCCeeEEEeccccccc
Confidence            334444444332 33999999999999999999999999999 999999999999999999999999999987777 889


Q ss_pred             CCccEEEeeCCCCccccCcHhHHHHHHhcCCCCCCCCCccccCCCCCCCCcccccCCCCCcccCccCCCce
Q psy14513         95 DSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKGAL  165 (209)
Q Consensus        95 ~~L~~l~l~~Np~~C~C~~~~~~~~~~~~~~~~~~~~~~~~C~~p~~l~g~~l~~~~~~~~~~~~C~~~~~  165 (209)
                      .+|.++.+-.|||.|+|.+.|+.+|++++..     ..+..|..|.-+++.++.++..   .++.|..+.+
T Consensus       346 ~~l~~l~l~~Np~~CnC~l~wl~~Wlr~~~~-----~~~~~Cq~p~~~~~~~~~dv~~---~~~~c~~~ee  408 (498)
T KOG4237|consen  346 FSLSTLNLLSNPFNCNCRLAWLGEWLRKKSV-----VGNPRCQSPGFVRQIPISDVAF---GDFRCGGPEE  408 (498)
T ss_pred             ceeeeeehccCcccCccchHHHHHHHhhCCC-----CCCCCCCCCchhccccchhccc---cccccCCccc
Confidence            9999999999999999999999999965542     3568999999999999999997   8888875433



>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF01463 LRRCT: Leucine rich repeat C-terminal domain; InterPro: IPR000483 Leucine-rich repeats (LRR, see IPR001611 from INTERPRO) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF05393 Hum_adeno_E3A: Human adenovirus early E3A glycoprotein; InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2 Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF05568 ASFV_J13L: African swine fever virus J13L protein; InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ] Back     alignment and domain information
>PF06679 DUF1180: Protein of unknown function (DUF1180); InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 1e-09
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 5e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 6e-07
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 6e-07
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 2e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 3e-06
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 3e-06
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 3e-06
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 9e-06
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 1e-05
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 1e-05
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 9e-05
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 3e-04
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 3e-04
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 4e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 4e-04
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 37/122 (30%), Positives = 66/122 (54%), Gaps = 6/122 (4%) Query: 31 ANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPH- 89 +N+ + + +F N+ L TL ++N +L I P +F+ SL+ ++ N I+ +P Sbjct: 62 SNNRISTLSNQSFSNMTQLLTLILSYN-RLRCIPPRTFDGLKSLRLLSLHGNDISVVPEG 120 Query: 90 ELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLS 149 D +L L I +NP CDC++QWL D+V K + +P + C+ P + ++ LL+ Sbjct: 121 AFNDLSALSHLAIGANPLYCDCNMQWLSDWV-KSEYKEPGIA---RCAGPGEMADKLLLT 176 Query: 150 NP 151 P Sbjct: 177 TP 178
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-15
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-04
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
 Score = 86.0 bits (213), Expect = 5e-20
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 4/117 (3%)

Query: 34  ELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHE-LG 92
               IR  +F  L +L+ L+   + +++ I   +F+   SL E  + +N ++SLPH+   
Sbjct: 229 HFPEIRPGSFHGLSSLKKLWVMNS-QVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFT 287

Query: 93  DWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLS 149
               L  L +  NPW CDC I WL  ++  R+           C  P+     +L+ 
Sbjct: 288 PLRYLVELHLHHNPWNCDCDILWLAWWL--REYIPTNSTCCGRCHAPMHMRGRYLVE 342


>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.88
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.72
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.72
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.67
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.57
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.57
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.51
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.51
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.5
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.47
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.43
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.4
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.33
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.32
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.31
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.25
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.22
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.1
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.1
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.03
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.03
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.02
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.01
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.01
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.97
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.97
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.96
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.96
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.95
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.94
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.93
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.86
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.84
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.83
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.79
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.79
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.77
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.75
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.7
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.67
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.64
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.63
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.6
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.58
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.55
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.51
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.51
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.49
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.47
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.44
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.42
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.39
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.38
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.38
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.37
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.27
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.27
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.25
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.98
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.57
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.54
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.52
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.81
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.41
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 96.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.19
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 95.71
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 95.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.66
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.27
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 95.03
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 93.31
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 92.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 90.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.55
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 88.87
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=2.1e-22  Score=154.39  Aligned_cols=125  Identities=29%  Similarity=0.537  Sum_probs=111.0

Q ss_pred             ccccccccCchhhcCCcccceecccccccccccCccccCCCCCcCEEeccCCcCcccCCCC-CCCCCccEEEeeCCCCcc
Q psy14513         31 ANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHEL-GDWDSLEVLDIQSNPWTC  109 (209)
Q Consensus        31 s~n~l~~l~~~~f~~l~~L~~L~Ls~n~~l~~i~~~~f~~l~~L~~L~Ls~N~l~~l~~~~-~~l~~L~~l~l~~Np~~C  109 (209)
                      ++|.|+.+++++|.++++|++|+|++| .++.+++.+|.++++|++|+|++|+++.++... ..+++|+.+++++|||.|
T Consensus        62 s~N~i~~i~~~~f~~l~~L~~L~Ls~N-~l~~i~~~~f~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~~~C  140 (193)
T 2wfh_A           62 SNNRISTLSNQSFSNMTQLLTLILSYN-RLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYC  140 (193)
T ss_dssp             CSSCCCCCCTTTTTTCTTCCEEECCSS-CCCBCCTTTTTTCTTCCEEECCSSCCCBCCTTTTTTCTTCCEEECCSSCEEC
T ss_pred             CCCcCCEeCHhHccCCCCCCEEECCCC-ccCEeCHHHhCCCCCCCEEECCCCCCCeeChhhhhcCccccEEEeCCCCeec
Confidence            899999999999999999999999999 999999999999999999999999999999876 889999999999999999


Q ss_pred             ccCcHhHHHHHHhcCCCCCCCCCccccCCCCCCCCcccccCCCCCcccCccCCC
Q psy14513        110 DCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVHLLSNPLLSHISGECVKG  163 (209)
Q Consensus       110 ~C~~~~~~~~~~~~~~~~~~~~~~~~C~~p~~l~g~~l~~~~~~~~~~~~C~~~  163 (209)
                      ||++.|+..|+....    .......|+.|+.++|+.+.+++.   ....|...
T Consensus       141 ~c~l~~l~~~~~~~~----~~~~~~~C~~P~~l~g~~l~~~~~---~~~~~~~~  187 (193)
T 2wfh_A          141 DCNMQWLSDWVKSEY----KEPGIARCAGPGEMADKLLLTTPS---KKFTCAAA  187 (193)
T ss_dssp             SGGGHHHHHHHHHSS----CCCSCCBEEESGGGTTCBTTTSCG---GGCCC---
T ss_pred             CCcCHHHHHHHHhcc----CCCCCcCcCCchHHCCCCcccCCh---HHeeehhh
Confidence            999999999995432    223568999999999999999997   66666543



>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-08
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.3 bits (134), Expect = 3e-10
 Identities = 14/77 (18%), Positives = 26/77 (33%)

Query: 48  NLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNAITSLPHELGDWDSLEVLDIQSNPW 107
                    N  LT +     N   +L    +  N++ ++P        L    +  NPW
Sbjct: 148 PKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPW 207

Query: 108 TCDCSIQWLIDYVAKRQ 124
            C+C I +   ++    
Sbjct: 208 LCNCEILYFRRWLQDNA 224


>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.22
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.14
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.09
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.04
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.02
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.01
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.89
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.56
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.51
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.33
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.32
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.21
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.07
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.94
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.79
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.9
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.77
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.29
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 95.96
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 95.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 86.07
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: High affinity nerve growth factor receptor, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=7.7e-23  Score=150.07  Aligned_cols=135  Identities=19%  Similarity=0.299  Sum_probs=110.4

Q ss_pred             CCCCCCcccccCCcccccceeccccccccccccccCchhhcCCcccceecccccccccccCccccCCCCCcCEEeccCCc
Q psy14513          4 KQNSGSRQDISYDTQYTIMKVQLPYSTANSELYAIRKNTFKNLLNLQTLYCNFNPKLTFIHPYSFNNDWSLKEFYINNNA   83 (209)
Q Consensus         4 ~~~~~~~~~~~~~~~~~l~~L~ll~~~s~n~l~~l~~~~f~~l~~L~~L~Ls~n~~l~~i~~~~f~~l~~L~~L~Ls~N~   83 (209)
                      ++....|..++..+  ++..|.+   .++|.|+.+++++|.++++|+.|++++| +|+.|++++|.++++|++|+|++|+
T Consensus        18 ~~~~~~p~~l~~l~--~l~~L~l---~~n~~l~~i~~~~f~~l~~L~~L~Ls~N-~l~~i~~~~f~~l~~L~~L~Ls~N~   91 (156)
T d2ifga3          18 DGALDSLHHLPGAE--NLTELYI---ENQQHLQHLELRDLRGLGELRNLTIVKS-GLRFVAPDAFHFTPRLSRLNLSFNA   91 (156)
T ss_dssp             SCCCTTTTTSCSCS--CCSEEEC---CSCSSCCEECGGGSCSCCCCSEEECCSS-CCCEECTTGGGSCSCCCEEECCSSC
T ss_pred             CCCccCcccccCcc--ccCeeec---CCCccccccCchhhccccccCcceeecc-ccCCcccccccccccccceeccCCC
Confidence            44455666665543  3345555   2345699999999999999999999999 9999999999999999999999999


Q ss_pred             CcccCCCCCCCCCccEEEeeCCCCccccCcHhHHHHHHhcCCCCCCCCCccccCCCCCCCCcc
Q psy14513         84 ITSLPHELGDWDSLEVLDIQSNPWTCDCSIQWLIDYVAKRQRTDPELNYNLHCSQPVKFSNVH  146 (209)
Q Consensus        84 l~~l~~~~~~l~~L~~l~l~~Np~~C~C~~~~~~~~~~~~~~~~~~~~~~~~C~~p~~l~g~~  146 (209)
                      ++++|........|+.|+|++|||.|||++.|+..|+......  .....+.|.+|..++|.+
T Consensus        92 l~~l~~~~~~~~~l~~L~L~~Np~~C~C~~~~l~~~~~~~~~~--~~~~~~~C~~p~~l~~~p  152 (156)
T d2ifga3          92 LESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGG--VPEQKLQCHGQGPLAHMP  152 (156)
T ss_dssp             CSCCCSTTTCSCCCCEEECCSSCCCCCGGGHHHHHHHHTTCSS--CGGGCCCCSSSSCSSCCC
T ss_pred             CcccChhhhccccccccccCCCcccCCchHHHHHHHHHhccCc--cCcCCcEECcChHHCcCC
Confidence            9999998844447999999999999999999999999543332  234679999999888854



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure