Diaphorina citri psyllid: psy14539

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MDSLFNAADLQNLSNLLNQGGNNNDSDSEEEMCSTSGRKKVGGASRHAPENPRFKVNIRRVTADDPSEESGPSNGKGDSAKTDEEDDKWAIWNKDEVPSMDTLPDDANLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF

ccccccHHHHHHHHHHHcccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEEEccHHHHHHccccccccccccccEEEEEEccccccccEEEEEEccEEEECcccEEEEcccccccccccccEEECccccEEEEEEEEEcccccccc

*****NA*DLQNLSNL***************************************************************************W******************PRITPEYDIMYQQSVTSEDIYLQMGGK***SVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein PIH1D3		confident	Q9NQM4

Prediction of Gene Ontology Terms

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EUD, chain A
Confidence level:confident
Coverage over the Query: 113-123,143-210
View the alignment between query and template
View the model in PyMOL