Psyllid ID: psy14539


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MDSLFNAADLQNLSNLLNQGGNNNDSDSEEEMCSTSGRKKVGGASRHAPENPRFKVNIRRVTADDPSEESGPSNGKGDSAKTDEEDDKWAIWNKDEVPSMDTLPDDANLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF
ccccccHHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccHHHHHHccccccccccccccEEEEEEccccccccEEEEEEccEEEEEcccEEEEcccccccccccccEEEEccccEEEEEEEEEcccccccc
ccccccHHHHHHHHHHHccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccHHHccHHccccccccccccccccEEEEEEEEcccccEEEccccccccccccccEEEEEEccccccccEEEEEEEEEEEEccccEEEEcccccccccccccEEEccccEEEEEEEEEEEcccEEcc
MDSLFNAADLQNLSNLLnqggnnndsdseeemcstsgrkkvggasrhapenprfkvnirrvtaddpseesgpsngkgdsaktdeeddkwaiwnkdevpsmdtlpddanldpritpeydimyqqsvtSEDIYlqmggktpssvscEDMLVTIqlpgeqrenvdcdlttqhvdirSIKYrlalplphpvlphlcqatwdsdKSELKLTLRLTREFDCVNF
MDSLFNAADLQNLSNLLNQGGNNNDSDSEEEMCSTSgrkkvggasrhapenprfkvnirrvtaddpseesgpsngkgdsaktdeeddkWAIWnkdevpsmdtlpddaNLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQlpgeqrenvdcDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLrltrefdcvnf
MDSLFnaadlqnlsnllnqggnnndsDSEEEMCSTSGRKKVGGASRHAPENPRFKVNIRRVTADDPSEESGPSNGKGDSAKTDEEDDKWAIWNKDEVPSMDTLPDDANLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLAlplphpvlphlCQATWDSDKSELKLTLRLTREFDCVNF
****************************************************************************************WAIW********************ITPEYDIMYQQSVTSEDIYLQMGGK***SVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDC***
*****NA*DLQNLSNL**********************************************************************************************PRITPEYDIMYQQSVTSEDIYLQMGG*****VSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF
MDSLFNAADLQNLSNLLNQGG****************************ENPRFKVNIRRVT***********************DDKWAIWNKDEVPSMDTLPDDANLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF
****FNAA*LQNLSNLLNQ************************************************************************WNKDEVPSMD*LPDDANLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLFNAADLQNLSNLLNQGGNNNDSDSEEEMCSTSGRKKVGGASRHAPENPRFKVNIRRVTADDPSEESGPSNGKGDSAKTDEEDDKWAIWNKDEVPSMDTLPDDANLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q9NQM4214 Protein PIH1D3 OS=Homo sa yes N/A 0.619 0.630 0.304 5e-13
>sp|Q9NQM4|PIHD3_HUMAN Protein PIH1D3 OS=Homo sapiens GN=PIH1D3 PE=2 SV=1 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 77/138 (55%), Gaps = 3/138 (2%)

Query: 81  KTDEEDDKWAIWNKDEVPSMDTLPDDANLDPRITPEYDIMYQQSVTSEDIYLQMGGKTPS 140
           +T EE+++  IWN +E+P  +    D   D R  PEY+I+++Q V +EDI+L +  K  S
Sbjct: 79  ETSEENNE-DIWNSEEIP--EGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSS 135

Query: 141 SVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKYRLALPLPHPVLPHLCQATWDSDK 200
           +  C +++  I+LP     ++  D+    +D+R+ + +L + LP  V     +A +  + 
Sbjct: 136 TGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPET 195

Query: 201 SELKLTLRLTREFDCVNF 218
             L++T+ + RE D  NF
Sbjct: 196 ETLEITMTMKRELDIANF 213





Homo sapiens (taxid: 9606)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
322792663192 hypothetical protein SINV_06329 [Solenop 0.866 0.984 0.389 2e-31
291223491190 PREDICTED: hypothetical protein [Saccogl 0.669 0.768 0.460 2e-30
332030531195 Uncharacterized protein CXorf41 [Acromyr 0.894 1.0 0.380 9e-30
198431063196 PREDICTED: similar to SJCHGC08782 protei 0.848 0.943 0.370 7e-28
350401468191 PREDICTED: uncharacterized protein CXorf 0.871 0.994 0.378 8e-28
340729080191 PREDICTED: uncharacterized protein CXorf 0.871 0.994 0.378 2e-27
307200231192 Uncharacterized protein CXorf41 [Harpegn 0.880 1.0 0.376 1e-26
260806783192 hypothetical protein BRAFLDRAFT_119143 [ 0.577 0.656 0.476 2e-26
115670823188 PREDICTED: uncharacterized protein CXorf 0.577 0.670 0.460 5e-26
390336379188 PREDICTED: uncharacterized protein CXorf 0.577 0.670 0.460 5e-26
>gi|322792663|gb|EFZ16537.1| hypothetical protein SINV_06329 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 124/221 (56%), Gaps = 32/221 (14%)

Query: 1   MDSLFNAADLQNLSNLLNQGGNNNDSDSEEEMCSTSGRKKVGGASRHAPENPRFKVNIRR 60
           MD  F   DL+ L NL+      +DSD E+++   +G +K+G A   AP           
Sbjct: 1   MDGCFRPGDLEALQNLICP--PKDDSDIEDDL-PQAGARKLGPADIGAP----------- 46

Query: 61  VTADDPSEESGPS---NGKGDSAKTDEEDDKWAIWNKDEVPSMDTLPDDANLDPRITPEY 117
            + +   E +GP     G GD            IW+  E   + +L D    DPR  PEY
Sbjct: 47  -SVESSQERAGPHASLQGAGDD-----------IWHPSETVDIRSLQD---YDPRKAPEY 91

Query: 118 DIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSIKY 177
           ++ ++Q+VT+ED+YL +G KTPS+ SCE + V ++LP E RE V+  + ++ +D+RS +Y
Sbjct: 92  EMKFKQAVTAEDVYLGIGFKTPSTASCEWLSVLVKLPEETREKVELSVESEAIDVRSPRY 151

Query: 178 RLALPLPHPVLPHLCQATWDSDKSELKLTLRLTREFDCVNF 218
           RL LP PHPV P+   A W +D S L++TLRLTRE D VNF
Sbjct: 152 RLHLPTPHPVDPNASSAKWHNDTSTLEVTLRLTRELDNVNF 192




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|291223491|ref|XP_002731743.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|332030531|gb|EGI70219.1| Uncharacterized protein CXorf41 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|198431063|ref|XP_002127097.1| PREDICTED: similar to SJCHGC08782 protein [Ciona intestinalis] Back     alignment and taxonomy information
>gi|350401468|ref|XP_003486162.1| PREDICTED: uncharacterized protein CXorf41-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729080|ref|XP_003402836.1| PREDICTED: uncharacterized protein CXorf41-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307200231|gb|EFN80525.1| Uncharacterized protein CXorf41 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|260806783|ref|XP_002598263.1| hypothetical protein BRAFLDRAFT_119143 [Branchiostoma floridae] gi|229283535|gb|EEN54275.1| hypothetical protein BRAFLDRAFT_119143 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|115670823|ref|XP_001197112.1| PREDICTED: uncharacterized protein CXorf41-like isoform 1 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390336379|ref|XP_003724337.1| PREDICTED: uncharacterized protein CXorf41-like isoform 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NQM4PIHD3_HUMANNo assigned EC number0.30430.61920.6308yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
cd0646384 cd06463, p23_like, Proteins containing this p23_li 2e-05
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 0.001
pfam08190315 pfam08190, PIH1, pre-RNA processing PIH1/Nop17 0.002
>gnl|CDD|107220 cd06463, p23_like, Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
 Score = 41.5 bits (98), Expect = 2e-05
 Identities = 14/67 (20%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 145 EDMLVTIQLPGEQRENVDCDLTTQHVDIRSI-----KYRLALPLPHPVLPHLCQATWDSD 199
           +++ +TI L    +++V  + T + + +        +Y L   L  P+ P   + T +  
Sbjct: 6   DEVTITIPLKDVTKKDVKVEFTPKSLTVSVKGGGGKEYLLEGELFGPIDPEESKWTVEDR 65

Query: 200 KSELKLT 206
           K E+ L 
Sbjct: 66  KIEITLK 72


Both are co-chaperones for the heat shock protein (Hsp) 90. p23 binds Hsp90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor. p23 also has a passive chaperoning activity and in addition may participate in prostaglandin synthesis. Both p23 and Sba1p can regulate telomerase activity. This group includes domains similar to the C-terminal CHORD-SGT1 (CS) domain of suppressor of G2 allele of Skp1 (Sgt1). Sgt1 interacts with multiple protein complexes and has the features of a co-chaperone. Human (h) Sgt1 interacts with both Hsp70 and Hsp90, and has been shown to bind Hsp90 through its CS domain. Saccharomyces cerevisiae (Sc) Sgt1 is a subunit of both core kinetochore and SCF (Skp1-Cul1-F-box) ubiquitin ligase complexes. Sgt1 is required for pathogen resistance in plants. This group also includes the p23_like domains of human butyrate-induced transcript 1 (hB-ind1), NUD (nuclear distribution) C, Melusin, and NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR). hB-ind1 plays a role in the signaling pathway mediated by the small GTPase Rac1, NUDC is needed for nuclear movement, Melusin interacts with two splice variants of beta1 integrin, and NCB5OR plays a part in maintaining viable pancreatic beta cells. Length = 84

>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|219739 pfam08190, PIH1, pre-RNA processing PIH1/Nop17 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 99.86
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.17
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.16
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.12
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.12
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.1
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.1
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.09
PRK11597142 heat shock chaperone IbpB; Provisional 99.09
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.09
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.06
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.06
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.05
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.03
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.01
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.0
PRK10743137 heat shock protein IbpA; Provisional 99.0
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 98.92
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 98.91
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 98.9
cd0029880 ACD_sHsps_p23-like This domain family includes the 98.89
cd0646384 p23_like Proteins containing this p23_like domain 98.7
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 98.36
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.33
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 97.96
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 97.93
KOG4356|consensus310 97.73
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.58
KOG0710|consensus196 97.56
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.54
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.34
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.24
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 96.97
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.46
cd0648887 p23_melusin_like p23_like domain similar to the C- 96.4
KOG3591|consensus173 95.94
KOG3247|consensus 466 95.66
KOG1309|consensus 196 95.62
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 95.53
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.38
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 94.38
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 93.8
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 93.58
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
Probab=99.86  E-value=4.8e-21  Score=171.08  Aligned_cols=99  Identities=36%  Similarity=0.557  Sum_probs=91.9

Q ss_pred             CCCCCCCeEEEEEeeeccchhhhhhcCCCCCCCCCCCcEEEEEEcCCCC-CCcceEEEeCCEEEEEecc--eEEEcCCCC
Q psy14539        109 LDPRITPEYDIMYQQSVTSEDIYLQMGGKTPSSVSCEDMLVTIQLPGEQ-RENVDCDLTTQHVDIRSIK--YRLALPLPH  185 (218)
Q Consensus       109 ~d~r~~PeY~i~ykq~V~~eD~~lg~~~k~Pss~~~e~LvV~I~LPg~~-~~didLdV~e~~L~L~s~~--Y~L~L~LP~  185 (218)
                      ...+..|+|+|+|++.|+++|++.+++. + +++.|+.|+|+|+||++. .++|+|+|+++.|.|.++.  |+|+|+|||
T Consensus       227 ~~~~~~P~y~i~~~~~v~~~~~~~~~~~-~-~~~~p~~lvv~i~LP~~~s~~~i~LdV~~~~l~l~~~~~~y~L~l~LP~  304 (328)
T PF08190_consen  227 SPDPPKPEYSIVYRQQVDLEDVRDSSDS-D-SSGSPEELVVEIELPGVESASDIDLDVSEDRLSLSSPKPKYRLDLPLPY  304 (328)
T ss_pred             cccccCCcceEEeeccceeeeeeccccC-C-cCCCCceEEEEEECCCcCccceeEEEEeCCEEEEEeCCCceEEEccCCC
Confidence            3458899999999999999999988444 4 678999999999999996 9999999999999999876  999999999


Q ss_pred             CccCCCeeeEEECCCCEEEEEEec
Q psy14539        186 PVLPHLCQATWDSDKSELKLTLRL  209 (218)
Q Consensus       186 pVd~~~~kAkfd~~~g~L~VTLpv  209 (218)
                      +|+.+.|+|+|++++++|+|||||
T Consensus       305 ~V~~~~~~Akf~~~~~~L~vtlpV  328 (328)
T PF08190_consen  305 PVDEDNGKAKFDKKTKTLTVTLPV  328 (328)
T ss_pred             cccCCCceEEEccCCCEEEEEEEC
Confidence            999999999999999999999997



>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>KOG4356|consensus Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>KOG0710|consensus Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>KOG3591|consensus Back     alignment and domain information
>KOG3247|consensus Back     alignment and domain information
>KOG1309|consensus Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 99.59
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 99.43
4fei_A102 Heat shock protein-related protein; stress respons 99.29
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.27
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.27
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.22
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.19
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.19
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.17
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.09
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.04
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 98.95
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 98.76
2bol_A 314 TSP36, small heat shock protein; A-crystallin, mol 98.76
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.55
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.52
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.57
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.44
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.3
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 97.28
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 97.14
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 96.9
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 96.83
2o30_A131 Nuclear movement protein; MCSG, structural genomic 96.77
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 96.73
3igf_A374 ALL4481 protein; two-domained protein consisting o 96.55
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 96.21
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.59  E-value=3.4e-15  Score=120.55  Aligned_cols=67  Identities=15%  Similarity=0.202  Sum_probs=64.5

Q ss_pred             CCcEEEEEEcCCCC--CCcceEEEeCCEEEEEecceEEEcCCCCCc-cCCCeeeEEECCCCEEEEEEecc
Q psy14539        144 CEDMLVTIQLPGEQ--RENVDCDLTTQHVDIRSIKYRLALPLPHPV-LPHLCQATWDSDKSELKLTLRLT  210 (218)
Q Consensus       144 ~e~LvV~I~LPg~~--~~didLdV~e~~L~L~s~~Y~L~L~LP~pV-d~~~~kAkfd~~~g~L~VTLpv~  210 (218)
                      .+.|+|+|++|.++  +++++++|+++.|.+++++|+|+|+|||+| +.++++|+|+.++|.|+||||+.
T Consensus        12 ~e~viV~Ik~P~~~~~~sdiei~v~~~~F~F~~~PYyLRL~LP~~V~e~~~~kA~YD~d~~~~~VtLpK~   81 (134)
T 2k8q_A           12 EEFIFLKIFISNIRFSAVGLEIIIQENMIIFHLSPYYLRLRFPHELIDDERSTAQYDSKDECINVKVAKL   81 (134)
T ss_dssp             SSEEEEEEECCSSCCCSSSCCCEECSSSEEECSSSSCEEECCSSCEECCSSCEEEEETTTTEEEEEEEES
T ss_pred             CCEEEEEEEcCccccCccccEEEEeCCEEEEecCCeEEEecCCCeeecCCCcceeEeccCCEEEEEEeCC
Confidence            37999999999999  899999999999999999999999999999 78999999999999999999985



>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1rl1a_92 b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo 1e-04
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: GS domain
domain: Suppressor of G2 allele of skp1 homolog, gst1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.6 bits (87), Expect = 1e-04
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 145 EDMLVTIQLPGEQRENVDCDLTTQHVDIR-----SIKYRLALPLPHPVLPHLCQATWDSD 199
             +++T+ +   Q+ +V+ + + + +           Y L L L HP++P        S 
Sbjct: 12  SQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLST 71

Query: 200 KSELKL 205
           K E+KL
Sbjct: 72  KIEIKL 77


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.13
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 98.96
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 97.86
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 96.9
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 96.85
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 96.58
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 95.34
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=99.13  E-value=9.7e-11  Score=88.13  Aligned_cols=67  Identities=19%  Similarity=0.298  Sum_probs=60.7

Q ss_pred             CCCcEEEEEEcCCCCCCcceEEEeCCEEEEEec---------------------ceEEEcCCCCCccCCCeeeEEECCCC
Q psy14539        143 SCEDMLVTIQLPGEQRENVDCDLTTQHVDIRSI---------------------KYRLALPLPHPVLPHLCQATWDSDKS  201 (218)
Q Consensus       143 ~~e~LvV~I~LPg~~~~didLdV~e~~L~L~s~---------------------~Y~L~L~LP~pVd~~~~kAkfd~~~g  201 (218)
                      ..+.++|.++|||++.++|+|.|.++.|.|++.                     .|++.+.||..|+.++++|+|++  |
T Consensus        18 ~~~~~~i~~~lPG~~~edi~v~v~~~~l~I~~~~~~~~~~~~~~~~~~~~~~~~~f~r~~~lP~~vd~~~i~A~~~n--G   95 (115)
T d1shsa_          18 GDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFEN--G   95 (115)
T ss_dssp             CSSEEEEEEECTTCCGGGEEEEEETTEEEEEEECCCCCCCTTCEEEEECSCCCCEEEEEEECSSCBCGGGCEEEEET--T
T ss_pred             cCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEeccccccccccEEEEeeecccceEEEEecCCceeecceEEEEEC--C
Confidence            347899999999999999999999999999762                     26688999999999999999999  9


Q ss_pred             EEEEEEeccc
Q psy14539        202 ELKLTLRLTR  211 (218)
Q Consensus       202 ~L~VTLpv~r  211 (218)
                      +|+|+||...
T Consensus        96 vL~I~lpK~~  105 (115)
T d1shsa_          96 VLSVILPKAE  105 (115)
T ss_dssp             EEEEEEEBCG
T ss_pred             EEEEEEEeCC
Confidence            9999999764



>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure