Diaphorina citri psyllid: psy14541

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---

MRRNDQPIEQLGTFDPLPNEYQEKLVSLNIERIRYWLGTSDIHITSPVRELFGLAGLFPIYHRTYMNAWRNRNKAEAEIEKQKQEKLKAEQEANQDKEAASSA

ccccccccccccccccccccccccEEEEEHHHHHHHHHcccccccHHHHHHHHHcccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc

*RRNDQPIEQLGTFDPLPNEYQEKLVSLNIERIRYWLGTSDIHITSPVRELFGLAGLFPIYHRTYMNAWR*********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRRNDQPIEQLGTFDPLPNEYQEKLVSLNIERIRYWLGTSDIHITSPVRELFGLAGLFPIYHRTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSA

Annotation	Function Description	Confidence Level	Reference Protein
Probable 28S ribosomal protein S16, mitochondrial		confident	Q9V6Y3
28S ribosomal protein S16, mitochondrial		confident	Q5REY4
28S ribosomal protein S16, mitochondrial		confident	Q9CPX7

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

No EC number assigned to the protein, probably not an enzyme!

Template: 3BBN, chain P
Confidence level:very confident
Coverage over the Query: 1-61
View the alignment between query and template
View the model in PyMOL