Diaphorina citri psyllid: psy14557


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MSKAVDMELKKEHMSVFVLNGYEDLESFCEIKEEDLNYLKILNPEHRAKILAAVQVMHEYESPDEDEESSLDEDDSSFSGKHARNNLDSEHSTDDTRSTNTTSTTIVSNNSSLPYLTYKPNFHFVFDIFPGICRTSNQNDGHKAGVLIQHPLPLYPITLACDSSFSGKHARNNLDSEHSTDDTRSTNTTSTTIVSNNSSLINHKGDLISTEVSDTVVTCGDKAFAELQIKMMDTKQKLKIQDIQVENFKKNKHHTQLTLTEIKRLQPTTNTYESVGRMFIKTPHPEVVVNLEKKVKSYEEKIKDIESEKAIILVPALKIARYLVILIRLNTHCASLQV
cccccccHHHHHHHHHHHHcccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
********LKKEHMSVFVLNGYEDLESFCEIKEEDLNYLKILNPEHRAKILAAVQVMH********************************************************YLTYKPNFHFVFDIFPGICRTSNQNDGHKAGVLIQHPLPLYPITLACD******************************IVSNNS*LINHKGDLISTEVSDTVVTCGDKAFAELQIKMMDTKQKLKIQDIQVENFKKNKHHTQLTLTEIKRLQPTTNTYESVGRMFIKTPHPEVVVNLEKKVKSYEEKIKDIESEKAIILVPALKIARYLVILIRLNTHCA*LQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKAVDMELKKEHMSVFVLNGYEDLESFCEIKEEDLNYLKILNPEHRAKILAAVQVMHEYESPDEDEESSLDEDDSSFSGKHARNNLDSEHSTDDTRSTNTTSTTIVSNNSSLPYLTYKPNFHFVFDIFPGICRTSNQNDGHKAGVLIQHPLPLYPITLACDSSFSGKHARNNLDSEHSTDDTRSTNTTSTTIVSNNSSLINHKGDLISTEVSDTVVTCGDKAFAELQIKMMDTKQKLKIQDIQVENFKKNKHHTQLTLTEIKRLQPTTNTYESVGRMFIKTPHPEVxxxxxxxxxxxxxxxxxxxxxKAIILVPALKIARYLVILIRLNTHCASLQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Prefoldin subunit 1 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.confidentQ9CWM4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V38, chain A
Confidence level:very confident
Coverage over the Query: 2-62
View the alignment between query and template
View the model in PyMOL
Template: 2ZQM, chain A
Confidence level:confident
Coverage over the Query: 223-330
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 120-141
View the alignment between query and template
View the model in PyMOL