Diaphorina citri psyllid: psy14602


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRCR
cccccccEEEEEcccccccccccccccHHHHcHHHHHHcccccccccccEEEcccccccccccccc
*****GL*FMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQP********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SMG8 Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Probable component of kinase complex containing SMG1 and recruited to stalled ribosomes.confidentQ9VKQ6
Protein SMG8 Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Probable component of kinase complex containing SMG1 and recruited to stalled ribosomes.confidentB5E0H4
Protein SMG8 Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited by release factors to stalled ribosomes together with SMG1 and SMG9 (forming the SMG1C protein kinase complex) and, in the SMG1C complex, is required to mediate the recruitment of SMG1 to the ribosome:SURF complex and to suppress SMG1 kinase activity until the ribosome:SURF complex locates the exon junction complex (EJC). Acts as a regulator of kinase activity.confidentQ8VE18

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016071 [BP]mRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0045859 [BP]regulation of protein kinase activityprobableGO:0042325, GO:0032268, GO:0019220, GO:0019222, GO:0050790, GO:0060255, GO:0051246, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0065009, GO:0001932, GO:0050789, GO:0080090

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted