Psyllid ID: psy14602


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRCR
cccccccEEEEEcccccccccccccccHHHHcHHHHHHcccccccccccEEEcccccccccccccc
ccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccEEcccccccccc
mehssglrfmsscdcgrtqaqredpfslrEANYEFYQNVGVEcgcvalehypfpvfqpstedfrcr
mehssglrfmsscdcgrtqaqredpFSLREANYEFYQNVGVECGCVALEHypfpvfqpstedfrcr
MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRCR
**************************SLREANYEFYQNVGVECGCVALEHYPFPVFQ*********
*****GL*FMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQP********
**********SSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRCR
****SGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPS*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFRCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query66 2.2.26 [Sep-21-2011]
Q17G65 916 Protein SMG8 OS=Aedes aeg N/A N/A 0.984 0.070 0.575 1e-17
B0W730 912 Protein SMG8 OS=Culex qui N/A N/A 0.954 0.069 0.562 4e-17
B3N538 949 Protein SMG8 OS=Drosophil N/A N/A 0.969 0.067 0.553 8e-17
Q9VKQ6 944 Protein SMG8 OS=Drosophil yes N/A 0.969 0.067 0.538 3e-16
B4HWV2 927 Protein SMG8 OS=Drosophil N/A N/A 0.969 0.069 0.523 6e-16
B4MV81 953 Protein SMG8 OS=Drosophil N/A N/A 0.969 0.067 0.538 9e-16
B4P0U1 950 Protein SMG8 OS=Drosophil N/A N/A 0.969 0.067 0.523 1e-15
B4KKN5 967 Protein SMG8 OS=Drosophil N/A N/A 0.969 0.066 0.523 1e-15
B4Q9T2 944 Protein SMG8 OS=Drosophil N/A N/A 0.969 0.067 0.523 2e-15
B3MJV4 939 Protein SMG8 OS=Drosophil N/A N/A 0.969 0.068 0.523 2e-15
>sp|Q17G65|SMG8_AEDAE Protein SMG8 OS=Aedes aegypti GN=AAEL003157 PE=3 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 50/66 (75%), Gaps = 1/66 (1%)

Query: 1   MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVEC-GCVALEHYPFPVFQPS 59
           M+HSSG+ F+S+C+CGRTQ  REDP+++R+ANYEFYQ +   C  C  LE   FPVF+PS
Sbjct: 487 MDHSSGVVFVSACNCGRTQGHREDPYTIRQANYEFYQLIAKSCSNCTLLERIKFPVFEPS 546

Query: 60  TEDFRC 65
           + DFR 
Sbjct: 547 SSDFRA 552




Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Probable component of kinase complex containing SMG1 and recruited to stalled ribosomes.
Aedes aegypti (taxid: 7159)
>sp|B0W730|SMG8_CULQU Protein SMG8 OS=Culex quinquefasciatus GN=CPIJ003128 PE=3 SV=1 Back     alignment and function description
>sp|B3N538|SMG8_DROER Protein SMG8 OS=Drosophila erecta GN=GG10361 PE=3 SV=1 Back     alignment and function description
>sp|Q9VKQ6|SMG8_DROME Protein SMG8 OS=Drosophila melanogaster GN=CG6729 PE=2 SV=1 Back     alignment and function description
>sp|B4HWV2|SMG8_DROSE Protein SMG8 OS=Drosophila sechellia GN=GM11479 PE=3 SV=1 Back     alignment and function description
>sp|B4MV81|SMG8_DROWI Protein SMG8 OS=Drosophila willistoni GN=GK15451 PE=3 SV=1 Back     alignment and function description
>sp|B4P0U1|SMG8_DROYA Protein SMG8 OS=Drosophila yakuba GN=GE13372 PE=3 SV=1 Back     alignment and function description
>sp|B4KKN5|SMG8_DROMO Protein SMG8 OS=Drosophila mojavensis GN=GI17817 PE=3 SV=1 Back     alignment and function description
>sp|B4Q9T2|SMG8_DROSI Protein SMG8 OS=Drosophila simulans GN=GD22229 PE=3 SV=1 Back     alignment and function description
>sp|B3MJV4|SMG8_DROAN Protein SMG8 OS=Drosophila ananassae GN=GF14070 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
157134902 916 hypothetical protein AaeL_AAEL003157 [Ae 0.984 0.070 0.575 4e-16
345479316 905 PREDICTED: protein SMG8-like [Nasonia vi 0.984 0.071 0.538 1e-15
350411563 907 PREDICTED: protein SMG8-like [Bombus imp 0.954 0.069 0.571 1e-15
340729650 907 PREDICTED: protein SMG8-like [Bombus ter 0.954 0.069 0.571 1e-15
380017201 904 PREDICTED: protein SMG8-like [Apis flore 0.954 0.069 0.571 1e-15
328778764 904 PREDICTED: protein SMG8-like [Apis melli 0.954 0.069 0.571 1e-15
170033296 912 conserved hypothetical protein [Culex qu 0.954 0.069 0.562 1e-15
328711378 929 PREDICTED: protein SMG8-like [Acyrthosip 0.969 0.068 0.546 2e-15
307196259 908 UPF0487 protein C17orf71-like protein [H 0.969 0.070 0.562 2e-15
383851187 907 PREDICTED: protein SMG8-like [Megachile 0.954 0.069 0.571 3e-15
>gi|157134902|ref|XP_001656499.1| hypothetical protein AaeL_AAEL003157 [Aedes aegypti] gi|121957012|sp|Q17G65.1|SMG8_AEDAE RecName: Full=Protein SMG8; AltName: Full=Protein smg-8 homolog gi|108881359|gb|EAT45584.1| AAEL003157-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 50/66 (75%), Gaps = 1/66 (1%)

Query: 1   MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVEC-GCVALEHYPFPVFQPS 59
           M+HSSG+ F+S+C+CGRTQ  REDP+++R+ANYEFYQ +   C  C  LE   FPVF+PS
Sbjct: 487 MDHSSGVVFVSACNCGRTQGHREDPYTIRQANYEFYQLIAKSCSNCTLLERIKFPVFEPS 546

Query: 60  TEDFRC 65
           + DFR 
Sbjct: 547 SSDFRA 552




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345479316|ref|XP_001605859.2| PREDICTED: protein SMG8-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350411563|ref|XP_003489391.1| PREDICTED: protein SMG8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729650|ref|XP_003403110.1| PREDICTED: protein SMG8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380017201|ref|XP_003692549.1| PREDICTED: protein SMG8-like [Apis florea] Back     alignment and taxonomy information
>gi|328778764|ref|XP_001122102.2| PREDICTED: protein SMG8-like [Apis mellifera] Back     alignment and taxonomy information
>gi|170033296|ref|XP_001844514.1| conserved hypothetical protein [Culex quinquefasciatus] gi|239977613|sp|B0W730.1|SMG8_CULQU RecName: Full=Protein SMG8; AltName: Full=Protein smg-8 homolog gi|167873921|gb|EDS37304.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328711378|ref|XP_001942644.2| PREDICTED: protein SMG8-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307196259|gb|EFN77905.1| UPF0487 protein C17orf71-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383851187|ref|XP_003701120.1| PREDICTED: protein SMG8-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
UNIPROTKB|Q17G65 916 AAEL003157 "Protein SMG8" [Aed 0.969 0.069 0.584 4.1e-17
UNIPROTKB|B3N538 949 GG10361 "Protein SMG8" [Drosop 0.954 0.066 0.562 1.1e-16
FB|FBgn0032296 944 CG6729 [Drosophila melanogaste 0.954 0.066 0.546 3e-16
UNIPROTKB|B0W730 912 CPIJ003128 "Protein SMG8" [Cul 0.954 0.069 0.562 6e-16
UNIPROTKB|B4HWV2 927 GM11479 "Protein SMG8" [Drosop 0.954 0.067 0.531 6.2e-16
UNIPROTKB|B4MV81 953 GK15451 "Protein SMG8" [Drosop 0.954 0.066 0.546 1.1e-15
UNIPROTKB|B4P0U1 950 GE13372 "Protein SMG8" [Drosop 0.954 0.066 0.531 1.3e-15
UNIPROTKB|B4Q9T2 944 GD22229 "Protein SMG8" [Drosop 0.954 0.066 0.531 1.7e-15
UNIPROTKB|B3MJV4 939 GF14070 "Protein SMG8" [Drosop 0.954 0.067 0.531 2.2e-15
UNIPROTKB|B4KKN5 967 GI17817 "Protein SMG8" [Drosop 0.954 0.065 0.531 3.7e-15
UNIPROTKB|Q17G65 AAEL003157 "Protein SMG8" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 4.1e-17, P = 4.1e-17
 Identities = 38/65 (58%), Positives = 50/65 (76%)

Query:     1 MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECG-CVALEHYPFPVFQPS 59
             M+HSSG+ F+S+C+CGRTQ  REDP+++R+ANYEFYQ +   C  C  LE   FPVF+PS
Sbjct:   487 MDHSSGVVFVSACNCGRTQGHREDPYTIRQANYEFYQLIAKSCSNCTLLERIKFPVFEPS 546

Query:    60 TEDFR 64
             + DFR
Sbjct:   547 SSDFR 551




GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=ISS
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|B3N538 GG10361 "Protein SMG8" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
FB|FBgn0032296 CG6729 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B0W730 CPIJ003128 "Protein SMG8" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|B4HWV2 GM11479 "Protein SMG8" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4MV81 GK15451 "Protein SMG8" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B4P0U1 GE13372 "Protein SMG8" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B4Q9T2 GD22229 "Protein SMG8" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B3MJV4 GF14070 "Protein SMG8" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4KKN5 GI17817 "Protein SMG8" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VKQ6SMG8_DROMENo assigned EC number0.53840.96960.0677yesN/A
Q8VE18SMG8_MOUSENo assigned EC number0.51660.89390.0595yesN/A
Q0VA04SMG8_XENTRNo assigned EC number0.53330.89390.0644yesN/A
B5E0H4SMG8_DROPSNo assigned EC number0.50760.96960.0671yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
pfam10220 890 pfam10220, DUF2146, Uncharacterized conserved prot 1e-24
>gnl|CDD|220634 pfam10220, DUF2146, Uncharacterized conserved protein (DUF2146) Back     alignment and domain information
 Score = 94.2 bits (234), Expect = 1e-24
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 1/64 (1%)

Query: 1   MEHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPST 60
             H+SG+  +SSC+CGR Q  REDPF++++ANY+FYQ++  +C CV L  Y FP+FQPS+
Sbjct: 485 QAHNSGVIHVSSCNCGRKQGHREDPFTIKQANYDFYQHIAFKC-CVKLWRYQFPIFQPSS 543

Query: 61  EDFR 64
            D R
Sbjct: 544 SDIR 547


This is a family of proteins conserved from plants to humans. In Dictyostelium it is annotated as Mss11p but this could not be confirmed. Mss11p is required for the activation of pseudo-hyphal and invasive growth by Ste12p in yeast. Length = 890

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 66
KOG3692|consensus 881 99.96
PF10220 895 DUF2146: Uncharacterized conserved protein (DUF214 99.96
>KOG3692|consensus Back     alignment and domain information
Probab=99.96  E-value=2.5e-31  Score=216.68  Aligned_cols=62  Identities=53%  Similarity=1.075  Sum_probs=60.8

Q ss_pred             CcCCCceeeeecccCccccccCCCCchhhhchHHHHcccceeccccceeeeeccccCCCCCcc
Q psy14602          2 EHSSGLRFMSSCDCGRTQAQREDPFSLREANYEFYQNVGVECGCVALEHYPFPVFQPSTEDFR   64 (66)
Q Consensus         2 ~HsSg~~~~saCnCGR~q~~ReDPF~lk~AN~~FY~~~~~~C~C~~l~~i~Fpvf~ps~~d~~   64 (66)
                      .|+||++++|||||||+|+.|+|||+||+|||||||+++++| |++||+|||||||||++|++
T Consensus       481 ~Hns~~~~is~CnCGRkQ~~R~dPF~ik~ANydFY~h~~~kC-C~kl~~yqFpvfeps~~D~~  542 (881)
T KOG3692|consen  481 YHNSRARSISACNCGRKQAPRDDPFDIKAANYDFYQHLEEKC-CGKLDHYQFPVFEPSTPDPA  542 (881)
T ss_pred             eccccceeeeeeccccccCCCCCCcchhhccchHHHhhHHHH-hhhHhhccccccCCCCCCcc
Confidence            699999999999999999999999999999999999999999 99999999999999999985



>PF10220 DUF2146: Uncharacterized conserved protein (DUF2146); InterPro: IPR019354 Smg8 and Smg9 are two subunits of the Smg-1 complex Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00