Diaphorina citri psyllid: psy14605


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAFLKFQSAKDIDLAIQRGHWERRRYDRDREKEKKEKEEARIYGQMARQILLALFLGTGDR
cccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
*********EHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRC*******************EVLCAFLKFQSAKDIDLAIQRGHWE*******************IYGQMARQILLALFLGT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAFLKFQSAKDIDLAIQRGHWERRRYDRDREKEKKEKEEARIYGQMARQILLALFLGTGDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chromodomain-helicase-DNA-binding protein 3 Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Required for anchoring centrosomal pericentrin in both interphase and mitosis, for spindle organization and centrosome integrity.confidentQ12873
Protein let-418 Part of a NuRD (Nucleosome Remodeling and Deacetylase) complex which is implicated in the synMuv B pathway that negatively regulates specification of vulval cell fate. This negative regulation is thought to be mediated via interaction with the promoter of lin-39, a key regulator in vulva development, and is dependent on the presence lin-1. Contributes to negative regulation of lag-2 which is expressed in the gut during larval development. Has a broad role in development.confidentG5EBZ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0016581 [CC]NuRD complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0017053, GO:0000118, GO:0090545, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0051297 [BP]centrosome organizationprobableGO:0006996, GO:0031023, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0007017, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007051 [BP]spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0031491 [MF]nucleosome bindingprobableGO:0003682, GO:0003674, GO:0005488
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0042766 [BP]nucleosome mobilizationprobableGO:0034728, GO:0071824, GO:0044699, GO:0051276, GO:0006338, GO:0006325, GO:0009987, GO:0016043, GO:0043933, GO:0044763, GO:0071840, GO:0006996, GO:0008150, GO:0016568
GO:0016740 [MF]transferase activityprobableGO:0003824, GO:0003674
GO:0070615 [MF]nucleosome-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0004003 [MF]ATP-dependent DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0016462, GO:0003824
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0001103 [MF]RNA polymerase II repressing transcription factor bindingprobableGO:0001085, GO:0008134, GO:0003674, GO:0005488, GO:0005515, GO:0070491
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YSM, chain A
Confidence level:very confident
Coverage over the Query: 8-57
View the alignment between query and template
View the model in PyMOL