Psyllid ID: psy14605

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAFLKFQSAKDIDLAIQRGHWERRRYDRDREKEKKEKEEARIYGQMARQILLALFLGTGDR
cccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cccccccccccHHHHHHHccccEEEEEcccccEEEEEEccccccccccccccccccccccccccccccHHHHccccEEcccEEccccccccccEEcccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccc
MSHIQDLQTEHQDYCEVCQqggeiilcdtcprayhlccldpeldetpegkwscprcvsdgppetasppaeevKEKEVLCAFLKFQSAKDIDLAIQRGhwerrrydrdREKEKKEKEEARIYGQMARQILLALFLGTGDR
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAFLkfqsakdidlaiqrghwerrrydrdrekekkekeeariygqMARQILLALFLGTGDR
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAFLKFQSAKDIDLAIQRGHWerrrydrdrekekkekeearIYGQMARQILLALFLGTGDR
***********QDYCEVCQQGGEIILCDTCPRAYHLCCLDPELD******WSC**********************EVLCAFLKFQSAKDIDLAIQRGHWE*******************IYGQMARQILLALFLG****
*********EHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRC****************************************************************************FLGT***
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCP*******************EKEVLCAFLKFQSAKDIDLAIQRGHWERRR**************ARIYGQMARQILLALFLGTGDR
****QDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAFLKFQSAKDIDLAIQRGHWERRRYDRDREKEKKEKEEARIYGQMARQILLALFLGTG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAFLKFQSAKDIDLAIQRGHWERRRYDRDREKEKKEKEEARIYGQMARQILLALFLGTGDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
Q12873 2000 Chromodomain-helicase-DNA yes N/A 0.410 0.028 0.771 4e-23
O97159 1982 Chromodomain-helicase-DNA yes N/A 0.374 0.026 0.846 1e-22
Q8TDI0 1954 Chromodomain-helicase-DNA no N/A 0.381 0.027 0.811 2e-22
Q14839 1912 Chromodomain-helicase-DNA no N/A 0.431 0.031 0.666 5e-22
Q6PDQ2 1915 Chromodomain-helicase-DNA no N/A 0.431 0.031 0.666 5e-22
G5EBZ4 1829 Protein let-418 OS=Caenor yes N/A 0.410 0.031 0.507 3e-16
Q22516 1787 Chromodomain-helicase-DNA no N/A 0.395 0.030 0.545 6e-15
Q96BD5680 PHD finger protein 21A OS no N/A 0.330 0.067 0.565 5e-13
Q6ZPK0659 PHD finger protein 21A OS no N/A 0.330 0.069 0.543 2e-12
O16102 892 Chromodomain-helicase-DNA no N/A 0.330 0.051 0.5 5e-12
>sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%)

Query: 4   IQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDG 60
           +   +T+HQDYCEVCQQGGEIILCDTCPRAYHL CLDPELD  PEGKWSCP C  +G
Sbjct: 371 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHCEKEG 427
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Required for anchoring centrosomal pericentrin in both interphase and mitosis, for spindle organization and centrosome integrity.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=2 SV=1 Back     alignment and function description
>sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 Back     alignment and function description
>sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 Back     alignment and function description
>sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 Back     alignment and function description
>sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 Back     alignment and function description
>sp|Q96BD5|PF21A_HUMAN PHD finger protein 21A OS=Homo sapiens GN=PHF21A PE=1 SV=1 Back     alignment and function description
>sp|Q6ZPK0|PF21A_MOUSE PHD finger protein 21A OS=Mus musculus GN=Phf21a PE=1 SV=2 Back     alignment and function description
>sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
189240851 1966 PREDICTED: similar to chromodomain helic 0.388 0.027 0.851 1e-22
270013510 1969 hypothetical protein TcasGA2_TC012115 [T 0.388 0.027 0.851 1e-22
242023690 1999 Chromodomain helicase-DNA-binding protei 0.402 0.028 0.839 2e-22
157134600 1983 chromodomain helicase DNA binding protei 0.410 0.028 0.789 5e-22
393911013 1755 LET-418 protein [Loa loa] 0.424 0.033 0.728 1e-21
328716042 2002 PREDICTED: chromodomain-helicase-DNA-bin 0.352 0.024 0.897 1e-21
312372079 2227 hypothetical protein AND_20633 [Anophele 0.374 0.023 0.846 1e-21
158300661 2037 AGAP012009-PA [Anopheles gambiae str. PE 0.374 0.025 0.846 1e-21
312077956 1696 CHromoDomain protein family member [Loa 0.424 0.034 0.728 1e-21
440906808 1940 Chromodomain-helicase-DNA-binding protei 0.410 0.029 0.789 2e-21
>gi|189240851|ref|XP_001812556.1| PREDICTED: similar to chromodomain helicase-DNA-binding protein 3 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (92%)

Query: 10  EHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPE 63
           EHQDYCEVCQQGGEIILCDTCPRAYHL CLDPEL++TPEGKWSCP C ++GP E
Sbjct: 371 EHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEDTPEGKWSCPHCENEGPAE 424

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270013510|gb|EFA09958.1| hypothetical protein TcasGA2_TC012115 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242023690|ref|XP_002432264.1| Chromodomain helicase-DNA-binding protein, putative [Pediculus humanus corporis] gi|212517673|gb|EEB19526.1| Chromodomain helicase-DNA-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157134600|ref|XP_001663323.1| chromodomain helicase DNA binding protein [Aedes aegypti] gi|108870421|gb|EAT34646.1| AAEL013136-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|393911013|gb|EJD76123.1| LET-418 protein [Loa loa] Back     alignment and taxonomy information
>gi|328716042|ref|XP_003245819.1| PREDICTED: chromodomain-helicase-DNA-binding protein Mi-2 homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312372079|gb|EFR20122.1| hypothetical protein AND_20633 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158300661|ref|XP_320523.4| AGAP012009-PA [Anopheles gambiae str. PEST] gi|157013268|gb|EAA00692.4| AGAP012009-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312077956|ref|XP_003141528.1| CHromoDomain protein family member [Loa loa] Back     alignment and taxonomy information
>gi|440906808|gb|ELR57029.1| Chromodomain-helicase-DNA-binding protein 3, partial [Bos grunniens mutus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
UNIPROTKB|H7C2H0 525 CHD3 "Chromodomain-helicase-DN 0.517 0.137 0.666 1.9e-24
UNIPROTKB|F1LPP8 710 Chd3 "Protein Chd3" [Rattus no 0.517 0.101 0.652 9.5e-24
UNIPROTKB|E2RTI2 1998 CHD3 "Uncharacterized protein" 0.525 0.036 0.671 1.4e-23
UNIPROTKB|Q12873 2000 CHD3 "Chromodomain-helicase-DN 0.517 0.036 0.666 2.2e-23
UNIPROTKB|E9PG89 2059 CHD3 "Chromodomain-helicase-DN 0.517 0.034 0.666 2.3e-23
UNIPROTKB|F1N544 1998 CHD3 "Uncharacterized protein" 0.517 0.036 0.666 3.7e-23
RGD|1311923 1925 Chd3 "chromodomain helicase DN 0.517 0.037 0.652 4.5e-23
UNIPROTKB|F1LPP7 2020 Chd3 "Protein Chd3" [Rattus no 0.517 0.035 0.652 4.7e-23
UNIPROTKB|F1M7Q0 2054 Chd3 "Protein Chd3" [Rattus no 0.517 0.035 0.652 4.8e-23
FB|FBgn0262519 1982 Mi-2 [Drosophila melanogaster 0.539 0.037 0.632 7.6e-23
UNIPROTKB|H7C2H0 CHD3 "Chromodomain-helicase-DNA-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 1.9e-24, P = 1.9e-24
 Identities = 48/72 (66%), Positives = 54/72 (75%)

Query:     4 IQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPE 63
             +   +T+HQDYCEVCQQGGEIILCDTCPRAYHL CLDPELD  PEGKWSCP C  +G   
Sbjct:   242 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHCEKEGVQW 301

Query:    64 TASPPAEEVKEK 75
              A    EE +E+
Sbjct:   302 EAKEEEEEYEEE 313
GO:0003677 "DNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016818 "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|F1LPP8 Chd3 "Protein Chd3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTI2 CHD3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q12873 CHD3 "Chromodomain-helicase-DNA-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PG89 CHD3 "Chromodomain-helicase-DNA-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N544 CHD3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311923 Chd3 "chromodomain helicase DNA binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPP7 Chd3 "Protein Chd3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M7Q0 Chd3 "Protein Chd3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0262519 Mi-2 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q12873CHD3_HUMAN3, ., 6, ., 4, ., 1, 20.77190.41000.0285yesN/A
G5EBZ4LE418_CAEELNo assigned EC number0.50740.41000.0311yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
pfam0062851 pfam00628, PHD, PHD-finger 2e-10
smart0024947 smart00249, PHD, PHD zinc finger 5e-09
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 2e-05
cd11672120 cd11672, ADDz, ADDz for ATRX, Dnmt3 and Dnmt3l PHD 2e-04
cd11725126 cd11725, ADDz_Dnmt3, ADDz domain of DNA (cytosine- 6e-04
COG5034271 COG5034, TNG2, Chromatin remodeling protein, conta 0.001
cd11726127 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-tha 0.003
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 52.5 bits (126), Expect = 2e-10
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 5/51 (9%)

Query: 14 YCEVCQQ---GGEIILCDTCPRAYHLCCLDPELDET--PEGKWSCPRCVSD 59
          YC VC +    GE++LCD C R +HL CL P L+    PEG+W CP C   
Sbjct: 1  YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKPK 51

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|213032 cd11672, ADDz, ADDz for ATRX, Dnmt3 and Dnmt3l PHD-like zinc finger domain Back     alignment and domain information
>gnl|CDD|213033 cd11725, ADDz_Dnmt3, ADDz domain of DNA (cytosine-5) methyltransferases (C5-MTases) 3 (Dnmt3) Back     alignment and domain information
>gnl|CDD|227367 COG5034, TNG2, Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|213034 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-thalassemia/mental retardation, X-linked) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG0825|consensus 1134 99.18
KOG1244|consensus336 99.04
KOG4299|consensus 613 99.03
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 99.02
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.85
KOG1973|consensus274 98.8
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.8
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.56
KOG1512|consensus381 98.47
KOG0383|consensus 696 98.43
KOG0957|consensus707 98.05
KOG1245|consensus 1404 97.97
KOG4443|consensus 694 97.94
KOG0955|consensus 1051 97.84
KOG4323|consensus 464 97.83
KOG0954|consensus 893 97.72
COG5141 669 PHD zinc finger-containing protein [General functi 97.55
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.52
KOG1473|consensus 1414 97.47
KOG0956|consensus 900 97.46
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.53
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 94.37
KOG4299|consensus 613 94.15
KOG3612|consensus 588 93.32
KOG1246|consensus 904 92.55
KOG4443|consensus 694 92.39
KOG0957|consensus 707 92.34
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 91.49
KOG0383|consensus 696 89.59
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 88.81
KOG1473|consensus 1414 87.79
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.48
KOG4628|consensus348 86.24
KOG1512|consensus381 86.17
PF13901202 DUF4206: Domain of unknown function (DUF4206) 82.6
KOG1081|consensus 463 81.35
>KOG0825|consensus Back     alignment and domain information 
Probab=99.18  E-value=2e-11  Score=109.68  Aligned_cols=50  Identities=36%  Similarity=1.014  Sum_probs=44.2

Q ss_pred             cccccccccccC---ceEEeccCCCC-CcccccCCCCCCCCCCCccccccccCC
Q psy14605         11 HQDYCEVCQQGG---EIILCDTCPRA-YHLCCLDPELDETPEGKWSCPRCVSDG   60 (139)
Q Consensus        11 ~~~~C~vC~~~g---~ll~Cd~C~~~-~H~~Cl~P~l~~~p~~~W~C~~C~~~~   60 (139)
                      +...|.+|...+   -||+||.|+.+ ||+|||+|++..+|.+.|||++|+-..
T Consensus       214 E~~~C~IC~~~DpEdVLLLCDsCN~~~YH~YCLDPdl~eiP~~eWYC~NC~dL~  267 (1134)
T KOG0825|consen  214 EEVKCDICTVHDPEDVLLLCDSCNKVYYHVYCLDPDLSESPVNEWYCTNCSLLE  267 (1134)
T ss_pred             ccccceeeccCChHHhheeecccccceeeccccCcccccccccceecCcchhhh
Confidence            345699999875   49999999999 999999999999999999999998653

>KOG1244|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1973|consensus Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG0954|consensus Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>KOG3612|consensus Back     alignment and domain information
>KOG1246|consensus Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG1081|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 3e-20
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 2e-12
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 2e-12
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 5e-12
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 9e-12
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 5e-11
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 6e-11
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 3e-09
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 3e-09
4gnd_A107 Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains 3e-08
1f62_A51 Wstf-Phd Length = 51 1e-07
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 2e-06
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 3e-05
2ro1_A189 Nmr Solution Structures Of Human Kap1 Phd Finger-Br 5e-05
2ysm_A111 Solution Structure Of The First And Second Phd Doma 9e-05
1fp0_A88 Solution Structure Of The Phd Domain From The Kap-1 2e-04
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 2e-04
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 3e-04
2e6s_A77 Solution Structure Of The Phd Domain In Ring Finger 4e-04
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (85%)
Query: 4  IQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDG 60
          +   +T+HQDYCEVCQQGGEIILCDTCPRAYH+ CLDP++++ PEGKWSCP C  +G
Sbjct: 3  LGSYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEG 59
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|2RO1|A Chain A, Nmr Solution Structures Of Human Kap1 Phd Finger-Bromodomain Length = 189 Back     alignment and structure
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure
>pdb|1FP0|A Chain A, Solution Structure Of The Phd Domain From The Kap-1 Corepressor Length = 88 Back     alignment and structure
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure
>pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 5e-22
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 5e-22
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 1e-21
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 5e-21
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 9e-21
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-20
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 8e-17
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 3e-15
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 8e-15
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 2e-14
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 6e-14
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 6e-14
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 1e-13
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 2e-13
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-12
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 2e-12
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 3e-04
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-12
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 1e-11
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 3e-11
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 3e-10
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 5e-11
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 6e-11
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 3e-05
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-10
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 4e-10
2yt5_A66 Metal-response element-binding transcription facto 6e-10
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 3e-09
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-08
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 2e-08
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 8e-08
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 5e-06
1weu_A91 Inhibitor of growth family, member 4; structural g 1e-05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-05
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 2e-05
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 7e-05
1we9_A64 PHD finger family protein; structural genomics, PH 9e-05
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 3e-04
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
 Score = 82.1 bits (203), Expect = 5e-22
 Identities = 40/53 (75%), Positives = 48/53 (90%)

Query: 8  QTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDG 60
          +T+HQDYCEVCQQGGEIILCDTCPRAYH+ CLDP++++ PEGKWSCP C  +G
Sbjct: 7  ETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEG 59
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.75
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.72
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.7
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.69
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.67
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.65
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.64
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.59
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.58
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.57
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.57
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.56
2yt5_A66 Metal-response element-binding transcription facto 99.55
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.5
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.49
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.48
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.48
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.47
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.4
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.4
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.39
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.36
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.33
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.33
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 99.32
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.29
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.26
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.24
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.24
1weu_A91 Inhibitor of growth family, member 4; structural g 99.2
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.2
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.16
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.15
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 99.12
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.06
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.8
1we9_A64 PHD finger family protein; structural genomics, PH 98.74
1wee_A72 PHD finger family protein; structural genomics, PH 98.71
1wew_A78 DNA-binding family protein; structural genomics, P 98.63
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.62
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.62
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.61
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 98.55
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.54
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.49
1wem_A76 Death associated transcription factor 1; structura 98.47
1wil_A89 KIAA1045 protein; ring finger domain, structural g 98.42
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.4
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.38
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 98.36
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 98.28
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.22
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 97.8
3kv5_D 488 JMJC domain-containing histone demethylation prote 97.62
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 97.55
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 97.31
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 97.19
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.12
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 96.57
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 96.22
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 95.96
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 95.87
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 88.84
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 88.33
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 86.75
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 85.68
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 85.39
2ect_A78 Ring finger protein 126; metal binding protein, st 85.14
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 84.98
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 84.92
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 84.85
1weq_A85 PHD finger protein 7; structural genomics, PHD dom 84.05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 80.29
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 80.24
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
Probab=99.75  E-value=1.1e-18  Score=118.97  Aligned_cols=60  Identities=28%  Similarity=0.738  Sum_probs=55.8

Q ss_pred             CCCCCCCccccccccccccccCceEEeccCCCCCcccccCCCCCCCCCCCccccccccCC
Q psy14605          1 MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDG   60 (139)
Q Consensus         1 ~s~~d~~~~~~~~~C~vC~~~g~ll~Cd~C~~~~H~~Cl~P~l~~~p~~~W~C~~C~~~~   60 (139)
                      ||..+.+...++.+|.+|+++|+||+||.|+++||++|+.|++..+|.|+|+|+.|....
T Consensus        14 ~~~~~~~~d~n~~~C~vC~~~g~LL~CD~C~~~fH~~Cl~PpL~~~P~g~W~C~~C~~~~   73 (88)
T 1fp0_A           14 IIDEFGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLP   73 (88)
T ss_dssp             CCCCCCSSSSSSSCCSSSCSSSCCEECTTSSCEECTTSSSTTCCCCCSSSCCCCSCCCCC
T ss_pred             ccccccccCCCCCcCcCcCCCCCEEECCCCCCceecccCCCCCCCCcCCCcCCccccCCC
Confidence            567788888999999999999999999999999999999999999999999999998653
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 1e-16
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-16
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 9e-12
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 2e-10
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 3e-10
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 7e-10
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-08
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 4e-05
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 0.002
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 0.004
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Mi2-beta (CHD4)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.9 bits (163), Expect = 1e-16
 Identities = 26/49 (53%), Positives = 35/49 (71%)

Query: 10 EHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVS 58
           H ++C VC+ GGE++ CDTCP +YH+ CL+P L E P G+W CPRC  
Sbjct: 7  HHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTC 55
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.58
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.57
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.39
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 99.23
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.04
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.02
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.96
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.85
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 98.55
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.54
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.5
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.98
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 93.36
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 91.99
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 87.49
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 85.42
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 81.9
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Nuclear corepressor KAP-1 (TIF-1beta)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.58  E-value=7.6e-16  Score=98.93  Aligned_cols=53  Identities=32%  Similarity=0.861  Sum_probs=47.6

Q ss_pred             ccccccccccccCceEEeccCCCCCcccccCCCCCCCCCCCccccccccCCCC
Q psy14605         10 EHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPP   62 (139)
Q Consensus        10 ~~~~~C~vC~~~g~ll~Cd~C~~~~H~~Cl~P~l~~~p~~~W~C~~C~~~~~~   62 (139)
                      +...+|.+|+++|+||+||+|+++||+.|++|++..+|.+.|+|+.|......
T Consensus         5 d~c~~C~~C~~~~~ll~Cd~C~~~~H~~C~~p~l~~~p~~~W~C~~C~~~~~~   57 (70)
T d1fp0a1           5 DSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDL   57 (70)
T ss_dssp             SSSSCCSSSCSSSCCEECTTSSCEECTTSSSTTCCCCCSSSCCCCSCCCCCSS
T ss_pred             CCCCCCCCCCCcCEEEECCCCChhhccccCCCCcCcCCCCCEECcCCcCcCcc
Confidence            45678999999999999999999999999999999999999999999765443
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure