Diaphorina citri psyllid: psy14606


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAKCKSPGDQFLLCETCNGSYHPHCLPDPIEGELPTSGWKCPKCSCPPLPGKLEDMASLLRLPRQHR
cccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccCEEEcccccccccccccccccccccccccccccccccccccccHHHcEEEECcccccc
*******QTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAKCKSPGDQFLLCETCNGSYHPHCLPDPIEGELPTSGWKCPKCSCPP**GKLEDMASLLRLPRQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHIQDLQTEHQDYCEVCQQGGEIILCDTCPRAYHLCCLDPELDETPEGKWSCPRCVSDGPPETASPPAEEVKEKEVLCAKCKSPGDQFLLCETCNGSYHPHCLPDPIEGELPTSGWKCPKCSCPPLPGKLEDMASLLRLPRQHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chromodomain-helicase-DNA-binding protein Mi-2 homolog Vital role in development. Protein binds to a portion of Hunchback (HB) protein that is critical for repression of bithorax complex (BXC) genes. May also function in polycomb group (PcG) repression of Hox genes.confidentO97159

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051297 [BP]centrosome organizationprobableGO:0006996, GO:0031023, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0007017, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007051 [BP]spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0031491 [MF]nucleosome bindingprobableGO:0003682, GO:0003674, GO:0005488
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0042766 [BP]nucleosome mobilizationprobableGO:0034728, GO:0071824, GO:0044699, GO:0051276, GO:0006338, GO:0006325, GO:0009987, GO:0016043, GO:0043933, GO:0044763, GO:0071840, GO:0006996, GO:0008150, GO:0016568
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0070615 [MF]nucleosome-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0016581 [CC]NuRD complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0017053, GO:0000118, GO:0090545, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YSM, chain A
Confidence level:very confident
Coverage over the Query: 7-57,78-123
View the alignment between query and template
View the model in PyMOL
Template: 2LBM, chain A
Confidence level:very confident
Coverage over the Query: 49-130
View the alignment between query and template
View the model in PyMOL