Diaphorina citri psyllid: psy14648


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MVKYLARTYSKTLVFLITGLAIFSFRHRVEPALVIWSLILCLVGRACNIFPLAILVNRFREHQITRRMMFIMWFSGLRGAISYALSLHLEFSDETRHVIITSTLIIVLVTTLVFGGSTMPLMKILQTSSNQKIGRRRRGRKGKTAISLSKTKEW
cHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccc
MVKYLARTYSKTLVFLITGLAIFSFRHRVEPALVIWSLILCLVGRACNIFPLAILVNRFREHQITRRMMFIMWFSGLRGAISYALSLHLEFSDETRHVIITSTLIIVLVTTLVFGGSTMPLMKIL*****************************
xxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKYLARTYSKTLVFLITGLAIFSFRHRVEPALVIWSLILCLVGRACNIFPLAILVNRFREHQITRRMMFIMWFSGLRGAISYALSLHLEFSDETRHVIITSTLIIVLVTTLVFGGSTMPLMKILQTSSNQKIGRRRRGRKGKTAISLSKTKEW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 8 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentQ5ZJ75
Sodium/hydrogen exchanger 8 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentQ9Y2E8
Sodium/hydrogen exchanger 8 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentQ8R4D1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0051453 [BP]regulation of intracellular pHprobableGO:0019725, GO:0044699, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0030641
GO:0015386 [MF]potassium:hydrogen antiporter activityprobableGO:0022891, GO:0022890, GO:0015297, GO:0022892, GO:0015291, GO:0015491, GO:0005215, GO:0008324, GO:0015299, GO:0015298, GO:0015078, GO:0015075, GO:0022857, GO:0015077, GO:0003674, GO:0046873, GO:0005451, GO:0015079, GO:0022821, GO:0022804
GO:0015385 [MF]sodium:hydrogen antiporter activityprobableGO:0022891, GO:0022890, GO:0015297, GO:0022892, GO:0015291, GO:0015081, GO:0015491, GO:0005215, GO:0008324, GO:0015299, GO:0015298, GO:0015075, GO:0022857, GO:0015077, GO:0003674, GO:0046873, GO:0005451, GO:0015078, GO:0022804
GO:0035725 [BP]sodium ion transmembrane transportprobableGO:0009987, GO:0051234, GO:0006812, GO:0006811, GO:0006810, GO:0055085, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0044763, GO:0051179, GO:0006814, GO:0015672, GO:0044699
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KBV, chain A
Confidence level:probable
Coverage over the Query: 67-91
View the alignment between query and template
View the model in PyMOL