Diaphorina citri psyllid: psy14653


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MEEESQRPYKIIDYKRERKVGVVASSLEEIKRKAQDKLSNTSDNIKILLESDGTEIDEEDYFCTLENNTTLMVLFDNEKWTPVKQFVDAVDGSHHPLTQLLSLLQEDIGQLSLLGGQELELLSDMDPDNLLDIIPDKMFLNQVKEASCRFLSDKRNAQEALDLLKLYHKSYINNTNSNNDASQTKKTRLSP
ccccccccEEEEcccccCEEEEEEccHHHHHHHHHHHHcccccccEEEEcccccEEcccHHHcccccccEEEEEccccccccccccccccccccccHHHHHHHHHcccccCECccccHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
*****QR**KIIDYKRERKVGVVASSLEEIKRKAQDKLSNTSDNIKILLESDGTEIDEEDYFCTLENNTTLMVLFDNEKWTPVKQFVDAVDGSHHPLTQLLSLLQEDIGQLSLLGGQELELLSDMDPDNLLDIIPDKMFLNQVKEASCRFLSDKRNAQEALDLLKLYHKSYI*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEESQRPYKIIDYKRERKVGVVxxxxxxxxxxxxxxxxxxxxxIKILLESDGTEIDEEDYFCTLENNTTLMVLFDNEKWTPVKQFVDAVDGSHHPLTQLLSLLQEDIGQLSLLGGQELELLSDMDPDNLLDIIPDKMFLNQVKEASCRFLSDKRNAQEALDLLKLYHKSYINNTNSNNDASQTKKTRLSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D4B, chain A
Confidence level:very confident
Coverage over the Query: 3-86
View the alignment between query and template
View the model in PyMOL
Template: 1IYR, chain A
Confidence level:probable
Coverage over the Query: 97-164
View the alignment between query and template
View the model in PyMOL