Diaphorina citri psyllid: psy14657


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-----
MKAFKTNSLRRKGENGELTTLIEPNADEVHRTVSRFLFNRKLLSSAKDFAYAHMLLLTHFLHGKRKQQLANIREAEERYNAACETAARLTLENNFDLESPPMDFTYIPSSVPRDGVVVTDDPVIWCECRGNCVSNRDACCSDLNDADFAYSRRTKRLKLEKGTPIYECNKKCACDETCLNRVVQKGNLVQDCHTTITSRDGSVVLLRVADINLTKFSSDTMTEYEVESVLDSLELTSDMTVYLVKWKNYDPEYNTWEPIENLGNCAKKLAEFLKAGPDQERTDFEKMKSFLSQHTEEEVESVLAKLRNKKDFAYAHMLLLTHFLHGKRKQQLANIREAEERYNAACETAARLTLENNFDLESPPMDFTYIPSSVPRDGVVVTDDPVIWCECRGNCVSNRDACCSDLNDADFAYSRRTKRLKLEKGTPIYECNKKCACDETCLNRVVQKGITLPLTIFKTKNNRGWGVRTPDKIKAGTFVCEYVGEILTHENALQRTNQTYCFNLDFNQDSNSVAFVLDAARYGNVSHFINHSCDPNLEVSRINNLNPDLHHVALFAKRDINKNEELSFCYLDLTKAKFTSSKRKKLVRNECRCGSSNCLGYYYLN
cccccccccCCcccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccEECccccccccccccccccccccccccECccEEEEEEEEEECcccEEEEEEEEcccccccccccccHHHHHHHHcccccccccEEEEEEccccccccccccccccccccHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEECcccccccccccccccccccccccEEEEECcccccCEEEcccccccccEEEEEEEEEccHHHHHHHcccccccccccccccccccEEEccccccccccccccccccccEEEEEEEccccccEEEEEEcccccccccccccccccccccccccccccccccEEEccccccCCccccc
*************ENGELTTLIEPNADEVHRTVSRFLFNRKLLSSAKDFAYAHMLLLTHFLHGKRKQQLANIREAEERYNAACETAARLTLENNFDLESPPMDFTYIPSSVPRDGVVVTDDPVIWCECRGNCVSNRDACCSDLNDADFAYSRRTKRLKLEKGTPIYECNKKCACDETCLNRVVQKGNLVQDCHTTITSRDGSVVLLRVADINLTKFSSDTMTEYEVESVLDSLELTSDMTVYLVKWKNYDPEYNTWEPIENLGNCAKKLAEFLKAGPDQERTDFEKMKSFLSQHT***VESVLAKLRNKKDFAYAHMLLLTHFLHGKRKQQLANIREAEERYNAACETAARLTLENNFDLESPPMDFTYIPSSVPRDGVVVTDDPVIWCECRGNCVSNRDACCSDLNDADFAYSRRTKRLKLEKGTPIYECNKKCACDETCLNRVVQKGITLPLTIFKTKNNRGWGVRTPDKIKAGTFVCEYVGEILTHENALQRTNQTYCFNLDFNQDSNSVAFVLDAARYGNVSHFINHSCDPNLEVSRINNLNPDLHHVALFAKRDINKNEELSFCYLDLTKAKFTSSKRKKLVRNECRCGSSNCLGYYYLN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAFKTNSLRRKGENGELTTLIEPNADEVHRTVSRFLFNRKLLSSAKDFAYAHMLLLTHFLHGKxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNFDLESPPMDFTYIPSSVPRDGVVVTDDPVIWCECRGNCVSNRDACCSDLNDADFAYSRRTKRLKLEKGTPIYECNKKCACDETCLNRVVQKGNLVQDCHTTITSRDGSVVLLRVADINLTKFSSDTMTEYEVESVLDSLELTSDMTVYLVKWKNYDPEYNTWEPIENLGNCAKKLAEFLKAGPDQERTDFEKMKSFLSQHTEEEVESVLAKLRNKKDFAYAHMLLLTHFLHGKxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNFDLESPPMDFTYIPSSVPRDGVVVTDDPVIWCECRGNCVSNRDACCSDLNDADFAYSRRTKRLKLEKGTPIYECNKKCACDETCLNRVVQKGITLPLTIFKTKNNRGWGVRTPDKIKAGTFVCEYVGEILTHENALQRTNQTYCFNLDFNQDSNSVAFVLDAARYGNVSHFINHSCDPNLEVSRINNLNPDLHHVALFAKRDINKNEELSFCYLDLTKAKFTSSKRKKLVRNECRCGSSNCLGYYYLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone-lysine N-methyltransferase SUV39H2 Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher order chromatin organization during spermatogenesis.confidentQ9H5I1
Histone-lysine N-methyltransferase SUV39H2 Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher order chromatin organization during spermatogenesis.confidentQ32PH7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046974 [MF]histone methyltransferase activity (H3-K9 specific)probableGO:0018024, GO:0042054, GO:0003824, GO:0008757, GO:0016740, GO:0016278, GO:0016279, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000792 [CC]heterochromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0010369 [CC]chromocenterprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0000775 [CC]chromosome, centromeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0034968 [BP]histone lysine methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R3A, chain A
Confidence level:very confident
Coverage over the Query: 320-602
View the alignment between query and template
View the model in PyMOL
Template: 2R3A, chain A
Confidence level:very confident
Coverage over the Query: 58-232
View the alignment between query and template
View the model in PyMOL
Template: 2DNT, chain A
Confidence level:very confident
Coverage over the Query: 217-279
View the alignment between query and template
View the model in PyMOL