Diaphorina citri psyllid: psy14677

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---

MLTVEADAAALSTVLHQTVLKCSFSALIRYYQYRCLVRNHHHTQQVIPFNLPSLFLDGCNLCIELIDYILSSLTPNYCAFLFSGNTRKHIPSMNLDIRKKSRRKRVIALIQNLTQAQIPNMKRNLKRKSPKKKHQVVQALRVNDSEAVENKIKEEPTEEEKPRHHHHHHHRHRHHHKQERTELSDRHNLQENQRPRHEKPHSSDKHRHSSKTEPSERETKRNRQSHDDEETNERRHHDRNNRTHDNRHDERNSRQQNNERGSQDRRSNQSHDRPQSSSNSHHRDRGPKKPFCDASDEYEWGRKDANNEDNKNNAQQPKQKPDFGLSGKLTEDTNTYNGVVIKYSEPPDARKPKRRWRLYPFKGDTQLPVLHIHRQSAFLMGRDRKVADIPVDHPSCSKQHAALQYRLTDYTREDGSKGKRIRLYIIDLESANGTFVNNKKIDPKRYVELLEKDVIKFGFSSREYVLLHEHSKDSDYDDDVQDD

cccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHEEEEEcccccccEEcccccccccccccHHHHHHHHHHHcccccEEEEEECccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccEEEEEECccccccEEEEccEEEEEEccccccccccccccccccccEEEEEEEccccccccccccEEEEEEEEcccccccccccCCcccccEEEEccccEEEEcccEEEEEEEcccccccccccccccc

*******AAALSTVLHQTVLKCSFSALIRYYQYRCLVRNHHHTQQVIPFNLPSLFLDGCNLCIELIDYILSSLTPNYCAFLFSGNTRKHIPSM*************************************************************************************************************************************************************************************************************************************************TYNGVVIKYSEPPDARKPKRRWRLYPFKGDTQLPVLHIHRQSAFLMGRDRKVADIPVDHPSCSKQHAALQYRLTDYTREDGSKGKRIRLYIIDLESANGTFVNNKKIDPKRYVELLEKDVIKFGFSSREYVLLH***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
FHA domain-containing protein DDL	Involved in the microRNA (miRNA) and short interfering RNA (siRNA) biogenesis. May facilitate DCL1 to access or recognize primary miRNAs. Binds RNA non-specifically.	confident	Q8W4D8
Smad nuclear-interacting protein 1	Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis.	confident	Q8TAD8
Smad nuclear-interacting protein 1	Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis.	confident	Q8BIZ6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007249 [BP]	I-kappaB kinase/NF-kappaB cascade	probable	GO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0035196 [BP]	production of miRNAs involved in gene silencing by miRNA	probable	GO:0009892, GO:0019222, GO:0090304, GO:0031050, GO:0010629, GO:0006807, GO:0070887, GO:0050789, GO:0044699, GO:0070918, GO:0006139, GO:0051716, GO:0010605, GO:0044260, GO:0071359, GO:0010608, GO:1901360, GO:0040029, GO:0071704, GO:0010467, GO:0065007, GO:0014070, GO:0048519, GO:0010468, GO:0060255, GO:0009987, GO:0006725, GO:0071310, GO:0044763, GO:0031047, GO:0008152, GO:0042221, GO:0010033, GO:0046483, GO:0016070, GO:0044238, GO:0016458, GO:0035194, GO:0035195, GO:1901698, GO:1901699, GO:0034641, GO:0044237, GO:0043170, GO:0043331, GO:0071407, GO:0016441, GO:0008150, GO:0050896, GO:0006396
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ELV, chain A
Confidence level:very confident
Coverage over the Query: 342-467
View the alignment between query and template
View the model in PyMOL

Template: 3PGW, chain S
Confidence level:probable
Coverage over the Query: 293-304
View the alignment between query and template
View the model in PyMOL