Diaphorina citri psyllid: psy14695

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MGSTLRNMAQRYQAGLPQANPLTNLAEMTGIQKIDPIPADPMQLFKSWFTHHSELHSDSNLVANVMNVSTASKDGRVNSRSLILRRLDEDGFVIMTDGRSSKSKDLKENPNAAFTFLWINNVDGLYLARQIRIAGKVVQLETSNWIDIYEAEPLFCKIRAYVCHQGQPVDWDTHKKNHDELLSKFEKGQHDLARPDHVIAYKLFPTFMDFYESHGLKIADRLKYVRDNENAKDWECTRIAA
cccHHHHHHHHHHcccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccEEEEEEccccccEEEEEcccccHHHHHHHcccEEEEEccccccccccccccEEEEEEEEEccHHHHHHHHHcccccccccEEEcccccccccHHHHHHHHHHHHHHccccccccccccccCEEEEccEEEEEccccccccccEEEEEccccccccEEEEccc
***************************MTGIQKIDPIPADPMQLFKSWFTHHSELHSDSNLVANVMNVSTASKDGRVNSRSLILRRLDEDGFVIMTDGRSSKSKDLKENPNAAFTFLWINNVDGLYLARQIRIAGKVVQLETSNWIDIYEAEPLFCKIRAYVCHQGQPVDWDTHKKNHDELLSKFEKGQHDLARPDHVIAYKLFPTFMDFYESHGLKIADRLKYVRDNENAKDWECTRIAA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTLRNMAQRYQAGLPQANPLTNLAEMTGIQKIDPIPADPMQLFKSWFTHHSELHSDSNLVANVMNVSTASKDGRVNSRSLILRRLDEDGFVIMTDGRSSKSKDLKENPNAAFTFLWINNVDGLYLARQIRIAGKVVQLETSNWIDIYEAEPLFCKIRAYVCHQGQPVDWDTHKKNHDELLSKFEKGQHDLARPDHVIAYKLFPTFMDFYESHGLKIADRLKYVRDNENAKDWECTRIAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxine/pyridoxamine 5'-phosphate oxidase Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).confidentQ2S544
Pyridoxine/pyridoxamine 5'-phosphate oxidase Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).confidentA4JHA1
Pyridoxine/pyridoxamine 5'-phosphate oxidase Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).confidentB7JZR4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0009443 [BP]pyridoxal 5'-phosphate salvageprobableGO:0043094, GO:1901576, GO:0051186, GO:0071704, GO:0006732, GO:0019637, GO:0051188, GO:0044237, GO:0006796, GO:0044249, GO:0009058, GO:0009108, GO:0008150, GO:0008152, GO:0006793, GO:0042822, GO:0042823, GO:0009987, GO:0090407

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CI0, chain A
Confidence level:very confident
Coverage over the Query: 32-241
View the alignment between query and template
View the model in PyMOL