Diaphorina citri psyllid: psy14697


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
FGGCGSSWVLPSSFCWFGDWCGYFGLWSGRIGPSGRLMSPMELISGNKVVTAVAVGAAVVVGYCLYFDKKRRSDPLFKEKLKERRRKNRELLQQKNKRGIPDLKDHSAVQQYFLQEIQLGETLLAAGDLDNGVEHLANALTVCGQPNQLLGVLQQTLPPNVFNALIEKLPPAGIV
cccccccccccccccccccccccccccccccccccccccccHHcccHHHHHHHHHHHHHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccccccc
****GSSWVLPSSFCWFGDWCGYFGLWSGRIGPSGRLMSPMELISGNKVVTAVAVGAAVVVGYCLYFDKKRRSD********************************SAVQQYFLQEIQLGETLLAAGDLDNGVEHLANALTVCGQPNQLLGVLQQTLPPNVFNALIEKLPPA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FGGCGSSWVLPSSFCWFGDWCGYFGLWSGRIGPSGRLMSPMELISGNKVVTAVAVGAAVVVGYCLYFDKKRRSDPLFxxxxxxxxxxxxxxxxxxxxxGIPDLKDHSAVQQYFLQEIQLGETLLAAGDLDNGVEHLANALTVCGQPNQLLGVLQQTLPPNVFNALIEKLPPAGIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import receptor subunit TOM20 homolog Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore.confidentQ5RA31
Mitochondrial import receptor subunit TOM20 homolog Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore.confidentA6H7B1
Mitochondrial import receptor subunit TOM20 homolog Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore.confidentQ15388

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0015450 [MF]P-P-bond-hydrolysis-driven protein transmembrane transporter activityprobableGO:0008565, GO:0022891, GO:0022892, GO:0022884, GO:0005215, GO:0008320, GO:0015399, GO:0022857, GO:0003674, GO:0015405, GO:0022804
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006626 [BP]protein targeting to mitochondrionprobableGO:0008104, GO:0051649, GO:0071840, GO:0044699, GO:0070727, GO:0006886, GO:0016043, GO:0007005, GO:0071702, GO:0016482, GO:0006810, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0072655, GO:0006839, GO:0051234, GO:0051179, GO:0051641, GO:0006996, GO:0070585, GO:0033036, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0005742 [CC]mitochondrial outer membrane translocase complexprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031968, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0005741, GO:0044429, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OM2, chain A
Confidence level:very confident
Coverage over the Query: 96-173
View the alignment between query and template
View the model in PyMOL