Diaphorina citri psyllid: psy146

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---

MSHSNIIRKLKTLGYASPESFNPIREKEFRNMVVWLEDQKIRIYKIEDRAELRKLESPHWMNSFHQYCTDVGLPITLLSTPLEQIEWLLGHASRLEYADNVDQYKSQTAEFVSSNQSSAPKVVSTNPLDNLNFDSPEFKKGVNSLAEKLKIRPHPNHLTTLEACCKLISARLNEDALAHPEFVIPKGKPFPFLEIDNGFTLPDPVLNKAAKILNLLYIHDLRDLQTKINEAIVAVQTVTANPKTDTKLGKVGF

ccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc

****NII*KLKTLGYASPESFNPIREKEFRNMVVWLEDQKIRIYKIEDRAELRKLESPHWMNSFHQYCTDVGLPITLLSTPLEQIEWLLGHASRLEYADNVD*****************************NFDSPEFKKGVNSLAEKLKIRPHPNHLTTLEACCKLISARLNEDALAHPEFVIPKGKPFPFLEIDNGFTLPDPVLNKAAKILNLLYIHDLRDLQTKINEAIVAVQTVTANPKTDTKLGKVGF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UPF0568 protein C14orf166	Involved in modulation of mRNA transcription by Polymerase II. In case of infection by influenza virus A, is involved in viral replication.	confident	Q9Y224
UPF0568 protein C14orf166 homolog	Involved in modulation of mRNA transcription by Polymerase II.	confident	Q7ZUH1
UPF0568 protein C14orf166 homolog	Involved in modulation of mRNA transcription by Polymerase II.	confident	Q5R8I2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000993 [MF]	RNA polymerase II core binding	probable	GO:0019899, GO:0070063, GO:0043175, GO:0001098, GO:0001099, GO:0003674, GO:0005488, GO:0005515, GO:0032403
GO:0072669 [CC]	tRNA-splicing ligase complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IGP, chain A
Confidence level:probable
Coverage over the Query: 8-93
View the alignment between query and template
View the model in PyMOL