Diaphorina citri psyllid: psy14708

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---

MSLIKKPKKKPPASDWVKLEKSPVYKNDNTLRAYQLEGLNWLMFSWFNGRNCILADEMGLGKTIQSLTRNCILADEMGLGKTIQSLTFVDAVFKTGIRGPFLVIAPLSTIPNWQREFEAWTDLNVIVYHATFVVLLQTGSKFFRICLEFFVDAVFKTGIRGPFLVIAPLSTIPNWQREFEAWTDLNVIVYHGRRKKLSRRDKERLRLKYVAADYVPKDGEVLYGNWSRSECFKVERGLLTFGWGRWKEFLANNEFRNGWTEEYVEELARLLDLAGGDGKSFSPTMSSGTDGLKSASASRNMLQEYELFFRNDKNQFIKEKDLYKFHVLITTFEIIISDCLELKDFNWRLCIIDEAHRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEFGQLKTESEVNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNFSFLSKGTTSANVPNLMNTMMELRKCCIHPYLLNGKTYLL

ccccccccccccccccEEccccccccccccccHHHHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHccccccEEEEECcccHHHHHHHHcccccccEEEEEccHHHHHHHccEEEEEEEEEEEEcHHcccccccEEEEEcccccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccEEEECcccccEEEccccHHHHHHHHHHHccccccccccccccccccEEEEEccHHHHHHcccccccccccEEEEEccccccccccHHHHHHHccccccEEEEccccccccHHHHHHHHccccccccccHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHccccccCEEEEEEcccHHHHHHHHHHHHccHHHHHccccccccccHHHHHHHHHHHcccccccccccccc

*********************SPVYKNDNTLRAYQLEGLNWLMFSWFNGRNCILADEMGLGKTIQSLTRNCILADEMGLGKTIQSLTFVDAVFKTGIRGPFLVIAPLSTIPNWQREFEAWTDLNVIVYHATFVVLLQTGSKFFRICLEFFVDAVFKTGIRGPFLVIAPLSTIPNWQREFEAWTDLNVIVYHGRRKKLSRRDKERLRLKYVAADYVPKDGEVLYGNWSRSECFKVERGLLTFGWGRWKEFLANNEFRNGWTEEYVEELARLLDLAGGDGKSFSPTMSSGTDGLKSASASRNMLQEYELFFRNDKNQFIKEKDLYKFHVLITTFEIIISDCLELKDFNWRLCIIDEAHRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEFGQLK**SEVNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNFSFLSKGTTSANVPNLMNTMMELRKCCIHPYLLNGKTY**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chromodomain-helicase-DNA-binding protein 7	Probable transcription regulator.	confident	Q9P2D1
Chromodomain-helicase-DNA-binding protein 7	Probable transcription regulator.	confident	Q06A37
Chromodomain-helicase-DNA-binding protein 7	Probable transcription regulator.	confident	A2AJK6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008013 [MF]	beta-catenin binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0021545 [BP]	cranial nerve development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0021675, GO:0007275, GO:0044699
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0006338 [BP]	chromatin remodeling	probable	GO:0006996, GO:0051276, GO:0006325, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0016568
GO:0071339 [CC]	MLL1 complex	probable	GO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422, GO:0044665
GO:0044708 [BP]	single-organism behavior	probable	GO:0050896, GO:0008150, GO:0007610
GO:0060070 [BP]	canonical Wnt receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0050890 [BP]	cognition	probable	GO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0030178 [BP]	negative regulation of Wnt receptor signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0005694 [CC]	chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0002376 [BP]	immune system process	probable	GO:0008150
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0008094 [MF]	DNA-dependent ATPase activity	probable	GO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0060041 [BP]	retina development in camera-type eye	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0043009 [BP]	chordate embryonic development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0032508 [BP]	DNA duplex unwinding	probable	GO:0071103, GO:0032392, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0035064 [MF]	methylated histone residue binding	probable	GO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0030154 [BP]	cell differentiation	probable	GO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0042472 [BP]	inner ear morphogenesis	probable	GO:0042471, GO:0048598, GO:0048839, GO:0048562, GO:0044707, GO:0007423, GO:0048568, GO:0032501, GO:0048856, GO:0009887, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0060173 [BP]	limb development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0007275, GO:0048736
GO:0006357 [BP]	regulation of transcription from RNA polymerase II promoter	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0048806 [BP]	genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007507 [BP]	heart development	probable	GO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z3I, chain X
Confidence level:very confident
Coverage over the Query: 324-507
View the alignment between query and template
View the model in PyMOL

Template: 3MWY, chain W
Confidence level:very confident
Coverage over the Query: 15-49,69-96,158-201,304-475,487-509
View the alignment between query and template
View the model in PyMOL

Template: 3MWY, chain W
Confidence level:very confident
Coverage over the Query: 29-71,88-131
View the alignment between query and template
View the model in PyMOL