Psyllid ID: psy14708
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 513 | 2.2.26 [Sep-21-2011] | |||||||
| A2AJK6 | 2986 | Chromodomain-helicase-DNA | yes | N/A | 0.413 | 0.070 | 0.682 | 9e-86 | |
| Q9P2D1 | 2997 | Chromodomain-helicase-DNA | yes | N/A | 0.413 | 0.070 | 0.682 | 2e-85 | |
| Q06A37 | 3011 | Chromodomain-helicase-DNA | yes | N/A | 0.413 | 0.070 | 0.682 | 3e-85 | |
| Q8TD26 | 2715 | Chromodomain-helicase-DNA | no | N/A | 0.407 | 0.076 | 0.682 | 5e-84 | |
| Q9JIX5 | 2581 | Chromodomain-helicase-DNA | no | N/A | 0.409 | 0.081 | 0.669 | 7e-83 | |
| Q09XV5 | 2582 | Chromodomain-helicase-DNA | no | N/A | 0.409 | 0.081 | 0.669 | 7e-83 | |
| Q8BYH8 | 2885 | Chromodomain-helicase-DNA | no | N/A | 0.407 | 0.072 | 0.677 | 7e-83 | |
| Q9HCK8 | 2581 | Chromodomain-helicase-DNA | no | N/A | 0.409 | 0.081 | 0.669 | 8e-83 | |
| B5DE69 | 2184 | Chromodomain-helicase-DNA | no | N/A | 0.409 | 0.096 | 0.665 | 2e-82 | |
| B0R0I6 | 2511 | Chromodomain-helicase-DNA | no | N/A | 0.409 | 0.083 | 0.671 | 2e-82 |
| >sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 318 bits (814), Expect = 9e-86, Method: Compositional matrix adjust.
Identities = 146/214 (68%), Positives = 179/214 (83%), Gaps = 2/214 (0%)
Query: 295 ASASRNMLQEYELFFRNDKNQFIKEKDLYKFHVLITTFEIIISDCLELKDFNWRLCIIDE 354
+ ASR +Q YE++F++ + + IK YKFH +ITTFE+I++DC EL++ WR +IDE
Sbjct: 1039 SQASRRTIQLYEMYFKDPQGRVIKGS--YKFHAIITTFEMILTDCPELRNIPWRCVVIDE 1096
Query: 355 AHRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEF 414
AHRLKNRNCKLLEGL+++ LEH+VLL+GTPLQN V ELFSLL+FLEP +F + FM EF
Sbjct: 1097 AHRLKNRNCKLLEGLKMMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSRFPSETTFMQEF 1156
Query: 415 GQLKTESEVNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNF 474
G LKTE +V KLQ +LKPMMLRRLKEDVEK++APKEET++EVELTNIQKKYYR ILE+NF
Sbjct: 1157 GDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNF 1216
Query: 475 SFLSKGTTSANVPNLMNTMMELRKCCIHPYLLNG 508
+FLSKG ANVPNL+NTMMELRKCC HPYL+NG
Sbjct: 1217 TFLSKGGGQANVPNLLNTMMELRKCCNHPYLING 1250
|
Probable transcription regulator. Mus musculus (taxid: 10090) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2 |
| >sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 | Back alignment and function description |
|---|
| >sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 513 | ||||||
| 307172263 | 4304 | Chromodomain-helicase-DNA-binding protei | 0.413 | 0.049 | 0.841 | 1e-103 | |
| 328724512 | 4192 | PREDICTED: hypothetical protein LOC10016 | 0.413 | 0.050 | 0.836 | 1e-102 | |
| 307197292 | 4395 | Chromodomain-helicase-DNA-binding protei | 0.413 | 0.048 | 0.827 | 1e-101 | |
| 270007595 | 4075 | hypothetical protein TcasGA2_TC014275 [T | 0.413 | 0.052 | 0.813 | 1e-101 | |
| 242011216 | 4944 | conserved hypothetical protein [Pediculu | 0.413 | 0.042 | 0.822 | 1e-101 | |
| 383850307 | 4199 | PREDICTED: uncharacterized protein LOC10 | 0.413 | 0.050 | 0.831 | 1e-101 | |
| 189237363 | 4044 | PREDICTED: similar to kismet CG3696-PA [ | 0.413 | 0.052 | 0.813 | 1e-101 | |
| 350424228 | 4166 | PREDICTED: hypothetical protein LOC10074 | 0.413 | 0.050 | 0.831 | 1e-101 | |
| 345486061 | 4819 | PREDICTED: hypothetical protein LOC10011 | 0.413 | 0.043 | 0.817 | 1e-100 | |
| 332022432 | 4236 | Chromodomain-helicase-DNA-binding protei | 0.423 | 0.051 | 0.805 | 1e-100 |
| >gi|307172263|gb|EFN63768.1| Chromodomain-helicase-DNA-binding protein 7 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 382 bits (981), Expect = e-103, Method: Composition-based stats.
Identities = 180/214 (84%), Positives = 200/214 (93%), Gaps = 2/214 (0%)
Query: 295 ASASRNMLQEYELFFRNDKNQFIKEKDLYKFHVLITTFEIIISDCLELKDFNWRLCIIDE 354
++ASR MLQEYE++++N+K Q IK DL KF+VLITTFEIII+D EL+ +NWRLC+IDE
Sbjct: 1761 SAASRTMLQEYEVYYKNEKGQQIK--DLVKFNVLITTFEIIITDFNELRGYNWRLCVIDE 1818
Query: 355 AHRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEF 414
AHRLKNRNCKLLEGLR L+LEHRVLLSGTPLQNNVNELFSLLNFLEPQQFS+NEAF+ EF
Sbjct: 1819 AHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSSNEAFLKEF 1878
Query: 415 GQLKTESEVNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNF 474
G L +E EVNKLQLLLKPMMLRRLKEDVEKS+APKEETVVEVELTNIQKKYYRGILERNF
Sbjct: 1879 GNLSSEGEVNKLQLLLKPMMLRRLKEDVEKSLAPKEETVVEVELTNIQKKYYRGILERNF 1938
Query: 475 SFLSKGTTSANVPNLMNTMMELRKCCIHPYLLNG 508
SFL+KGTTSAN+PNLMNTMMELRKCCIHP+LLNG
Sbjct: 1939 SFLAKGTTSANIPNLMNTMMELRKCCIHPFLLNG 1972
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328724512|ref|XP_001948282.2| PREDICTED: hypothetical protein LOC100164870 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307197292|gb|EFN78584.1| Chromodomain-helicase-DNA-binding protein 7 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|270007595|gb|EFA04043.1| hypothetical protein TcasGA2_TC014275 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242011216|ref|XP_002426351.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510428|gb|EEB13613.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383850307|ref|XP_003700737.1| PREDICTED: uncharacterized protein LOC100883463 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|189237363|ref|XP_970443.2| PREDICTED: similar to kismet CG3696-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350424228|ref|XP_003493728.1| PREDICTED: hypothetical protein LOC100744744 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345486061|ref|XP_001602898.2| PREDICTED: hypothetical protein LOC100119051 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332022432|gb|EGI62740.1| Chromodomain-helicase-DNA-binding protein 7 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 513 | ||||||
| FB|FBgn0086902 | 5517 | kis "kismet" [Drosophila melan | 0.407 | 0.037 | 0.644 | 2.4e-109 | |
| UNIPROTKB|E1BS47 | 1326 | CHD7 "Chromodomain-helicase-DN | 0.413 | 0.159 | 0.570 | 3.4e-100 | |
| UNIPROTKB|F1NSG3 | 2248 | CHD7 "Chromodomain-helicase-DN | 0.413 | 0.094 | 0.570 | 8.7e-99 | |
| UNIPROTKB|F1NVT7 | 1257 | CHD6 "Uncharacterized protein" | 0.407 | 0.166 | 0.568 | 1e-98 | |
| UNIPROTKB|F1PWD8 | 2994 | CHD7 "Uncharacterized protein" | 0.413 | 0.070 | 0.570 | 1.2e-98 | |
| RGD|1311921 | 2985 | Chd7 "chromodomain helicase DN | 0.413 | 0.071 | 0.570 | 2.4e-98 | |
| MGI|MGI:2444748 | 2986 | Chd7 "chromodomain helicase DN | 0.413 | 0.070 | 0.570 | 2.4e-98 | |
| UNIPROTKB|F1RT88 | 2991 | CHD7 "Uncharacterized protein" | 0.413 | 0.070 | 0.570 | 2.4e-98 | |
| UNIPROTKB|Q9P2D1 | 2997 | CHD7 "Chromodomain-helicase-DN | 0.413 | 0.070 | 0.570 | 2.4e-98 | |
| UNIPROTKB|E1BPM4 | 2940 | CHD7 "Uncharacterized protein" | 0.413 | 0.072 | 0.570 | 2.9e-98 |
| FB|FBgn0086902 kis "kismet" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 721 (258.9 bits), Expect = 2.4e-109, Sum P(3) = 2.4e-109
Identities = 136/211 (64%), Positives = 162/211 (76%)
Query: 298 SRNMLQEYELFFRNDKNQFIKEKDLYKFHVLITTFEIIISDCLELKDFNWRLCIIDEAHR 357
S+ M+Q+YE +++ + + +KE KF+VLITTFE+I++D ++LK FNWRLC+IDEAHR
Sbjct: 2113 SKQMIQDYEYYYKTESGKVLKEP--IKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHR 2170
Query: 358 LKNRNCKXXXXXXXXXXXXXXXXSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEFGQL 417
LKNRNCK SGTPLQNN++ELFSLLNFLEP QFS+ E FMSEFG L
Sbjct: 2171 LKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSL 2230
Query: 418 KTESEVNXXXXXXXXXXXXXXXEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNFSFL 477
+TE EVN +DVEKS+APKEET++EVELTNIQKKYYRGILE+NFSFL
Sbjct: 2231 RTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFL 2290
Query: 478 SKGTTSANVPNLMNTMMELRKCCIHPYLLNG 508
KGTTSAN+PNLMNTMMELRKCCIHPYLLNG
Sbjct: 2291 KKGTTSANIPNLMNTMMELRKCCIHPYLLNG 2321
|
|
| UNIPROTKB|E1BS47 CHD7 "Chromodomain-helicase-DNA-binding protein 7" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NSG3 CHD7 "Chromodomain-helicase-DNA-binding protein 7" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NVT7 CHD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWD8 CHD7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1311921 Chd7 "chromodomain helicase DNA binding protein 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444748 Chd7 "chromodomain helicase DNA binding protein 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RT88 CHD7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P2D1 CHD7 "Chromodomain-helicase-DNA-binding protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPM4 CHD7 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q06A37 | CHD7_CHICK | 3, ., 6, ., 4, ., 1, 2 | 0.6822 | 0.4132 | 0.0704 | yes | N/A |
| A2AJK6 | CHD7_MOUSE | 3, ., 6, ., 4, ., 1, 2 | 0.6822 | 0.4132 | 0.0709 | yes | N/A |
| Q9P2D1 | CHD7_HUMAN | 3, ., 6, ., 4, ., 1, 2 | 0.6822 | 0.4132 | 0.0707 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4.12 | 0.737 |
| 3rd Layer | 3.6.4 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 513 | |||
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 1e-52 | |
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 1e-52 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 2e-27 | |
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 3e-22 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 7e-15 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 1e-12 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 1e-09 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-09 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 2e-08 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 2e-08 | |
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 4e-08 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 0.002 |
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
Score = 192 bits (489), Expect = 1e-52
Identities = 89/214 (41%), Positives = 140/214 (65%), Gaps = 10/214 (4%)
Query: 301 MLQEYELFFRNDKNQFIKEKDLY--KFHVLITTFEIIISDCLELKDFNWRLCIIDEAHRL 358
+L+ + ++ +E+ L KF V +T+FE+ I + LK F+WR IIDEAHR+
Sbjct: 244 VLRAVKFHGNPEERAHQREELLVAGKFDVCVTSFEMAIKEKTALKRFSWRYIIIDEAHRI 303
Query: 359 KNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEFGQLK 418
KN N L + +RL +R+L++GTPLQNN++EL++LLNFL P+ FS+ E F E+ Q+
Sbjct: 304 KNENSLLSKTMRLFSTNYRLLITGTPLQNNLHELWALLNFLLPEIFSSAETF-DEWFQIS 362
Query: 419 TESE----VNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNF 474
E++ V +L +L+P +LRRLK DVEK + PK+ET+++V ++ +QK+YY+ +L+++
Sbjct: 363 GENDQQEVVQQLHKVLRPFLLRRLKSDVEKGLPPKKETILKVGMSQMQKQYYKALLQKDL 422
Query: 475 SFLSKGTTSANVPNLMNTMMELRKCCIHPYLLNG 508
++ G L+N M+LRKCC HPYL G
Sbjct: 423 DVVNAG---GERKRLLNIAMQLRKCCNHPYLFQG 453
|
Length = 1033 |
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 513 | |||
| KOG0384|consensus | 1373 | 100.0 | ||
| KOG0385|consensus | 971 | 100.0 | ||
| KOG0387|consensus | 923 | 100.0 | ||
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 100.0 | |
| KOG0391|consensus | 1958 | 100.0 | ||
| KOG0389|consensus | 941 | 100.0 | ||
| KOG4439|consensus | 901 | 100.0 | ||
| KOG0392|consensus | 1549 | 100.0 | ||
| KOG1002|consensus | 791 | 100.0 | ||
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 100.0 | |
| KOG0388|consensus | 1185 | 100.0 | ||
| KOG0386|consensus | 1157 | 100.0 | ||
| KOG0390|consensus | 776 | 100.0 | ||
| KOG1015|consensus | 1567 | 100.0 | ||
| KOG0383|consensus | 696 | 100.0 | ||
| KOG1016|consensus | 1387 | 100.0 | ||
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 100.0 | |
| KOG1001|consensus | 674 | 100.0 | ||
| KOG0298|consensus | 1394 | 99.98 | ||
| KOG1000|consensus | 689 | 99.98 | ||
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.96 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.81 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.56 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 99.54 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.42 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.35 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.32 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.32 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.27 | |
| KOG1123|consensus | 776 | 99.2 | ||
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 99.15 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 99.11 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 99.01 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 98.9 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 98.87 | |
| KOG0354|consensus | 746 | 98.8 | ||
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 98.8 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 98.78 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 98.63 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.59 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 98.57 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 98.57 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 98.54 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 98.54 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 98.53 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 98.52 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 98.5 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 98.47 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 98.44 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 98.43 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 98.43 | |
| PTZ00424 | 401 | helicase 45; Provisional | 98.39 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 98.38 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 98.37 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 98.36 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 98.36 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 98.34 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 98.32 | |
| PTZ00110 | 545 | helicase; Provisional | 98.31 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 98.3 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 98.3 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 98.28 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 98.28 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 98.22 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 98.21 | |
| KOG0298|consensus | 1394 | 98.09 | ||
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 98.09 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 98.06 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 98.04 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 97.99 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.98 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 97.93 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 97.93 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 97.81 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 97.77 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 97.77 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 97.76 | |
| KOG4439|consensus | 901 | 97.75 | ||
| PRK09694 | 878 | helicase Cas3; Provisional | 97.74 | |
| KOG1002|consensus | 791 | 97.7 | ||
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 97.63 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 97.6 | |
| KOG1015|consensus | 1567 | 97.58 | ||
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 97.43 | |
| KOG0350|consensus | 620 | 97.41 | ||
| KOG1513|consensus | 1300 | 97.27 | ||
| PRK14701 | 1638 | reverse gyrase; Provisional | 97.26 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 97.25 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 97.08 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 97.08 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 97.08 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 97.06 | |
| KOG0947|consensus | 1248 | 97.03 | ||
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 97.03 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 96.99 | |
| KOG0952|consensus | 1230 | 96.97 | ||
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 96.94 | |
| KOG0331|consensus | 519 | 96.91 | ||
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.86 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 96.71 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 96.68 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.63 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 96.57 | |
| KOG0330|consensus | 476 | 96.51 | ||
| KOG0338|consensus | 691 | 96.5 | ||
| KOG0948|consensus | 1041 | 96.47 | ||
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 96.41 | |
| KOG1803|consensus | 649 | 96.36 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 96.36 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 96.32 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 96.2 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 96.12 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 96.08 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 96.02 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 96.0 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 96.0 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 95.84 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 95.84 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 95.77 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 95.74 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 95.6 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.51 | |
| KOG0353|consensus | 695 | 95.5 | ||
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 95.4 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 95.2 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 95.08 | |
| KOG1802|consensus | 935 | 94.95 | ||
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.89 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 94.84 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 94.72 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 94.68 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 94.68 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 94.66 | |
| KOG1001|consensus | 674 | 94.58 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 94.46 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 94.35 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 94.26 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 94.25 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 94.05 | |
| PF11496 | 297 | HDA2-3: Class II histone deacetylase complex subun | 94.03 | |
| KOG0328|consensus | 400 | 93.98 | ||
| KOG0951|consensus | 1674 | 93.98 | ||
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 93.87 | |
| KOG0385|consensus | 971 | 93.69 | ||
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 93.6 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 93.35 | |
| KOG1131|consensus | 755 | 93.08 | ||
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 93.08 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 93.06 | |
| KOG0343|consensus | 758 | 92.97 | ||
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 92.72 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 92.54 | |
| KOG0345|consensus | 567 | 92.32 | ||
| KOG0342|consensus | 543 | 92.1 | ||
| KOG4284|consensus | 980 | 92.01 | ||
| KOG0347|consensus | 731 | 91.86 | ||
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 91.8 | |
| KOG0335|consensus | 482 | 91.74 | ||
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 91.37 | |
| KOG0991|consensus | 333 | 91.15 | ||
| KOG0339|consensus | 731 | 90.84 | ||
| KOG0348|consensus | 708 | 90.84 | ||
| PF13245 | 76 | AAA_19: Part of AAA domain | 90.23 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 89.35 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 89.17 | |
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 88.99 | |
| KOG0389|consensus | 941 | 88.81 | ||
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 88.8 | |
| KOG0388|consensus | 1185 | 88.52 | ||
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 88.5 | |
| KOG0949|consensus | 1330 | 87.99 | ||
| PLN03025 | 319 | replication factor C subunit; Provisional | 87.93 | |
| KOG0340|consensus | 442 | 87.87 | ||
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 87.07 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 87.05 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 86.67 | |
| KOG1132|consensus | 945 | 86.45 | ||
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 86.37 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 85.67 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 85.41 | |
| KOG0384|consensus | 1373 | 85.15 | ||
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 85.07 | |
| PRK08727 | 233 | hypothetical protein; Validated | 84.46 | |
| KOG0337|consensus | 529 | 84.36 | ||
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 84.24 | |
| KOG0387|consensus | 923 | 83.83 | ||
| KOG0346|consensus | 569 | 83.45 | ||
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 83.21 | |
| KOG0391|consensus | 1958 | 82.83 | ||
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 82.24 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 82.05 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 81.94 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 81.65 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 81.43 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 81.19 | |
| KOG0920|consensus | 924 | 81.12 | ||
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 81.05 | |
| PRK06526 | 254 | transposase; Provisional | 81.03 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 80.99 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 80.98 | |
| KOG0922|consensus | 674 | 80.93 | ||
| KOG0336|consensus | 629 | 80.73 | ||
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 80.5 | |
| KOG0352|consensus | 641 | 80.38 | ||
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 80.22 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 80.17 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 80.14 |
| >KOG0384|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-55 Score=472.30 Aligned_cols=312 Identities=54% Similarity=1.006 Sum_probs=285.6
Q ss_pred CCCCCCCCCccccCCCCccCCccchhhHHhhHHHHHhhhcCCccccccccCCCCcchhhhhhcccccccCCCCchhhHHH
Q psy14708 8 KKKPPASDWVKLEKSPVYKNDNTLRAYQLEGLNWLMFSWFNGRNCILADEMGLGKTIQSLTRNCILADEMGLGKTIQSLT 87 (513)
Q Consensus 8 ~~~~~~~~~~~~~~~p~~~~~~~Lrp~Q~~~v~~m~~~~~~~~~~~l~~e~g~gkt~~~~~~GgiLademGlGKT~~~ia 87 (513)
...+....|.+++.+|.+..+.+||+||++|++||+..|-++.+ ||||||||||||+++|+
T Consensus 348 ~~~~~rp~~~Kle~qp~~~~g~~LRdyQLeGlNWl~~~W~~~~n-------------------~ILADEmgLgktvqti~ 408 (1373)
T KOG0384|consen 348 KYRPQRPRFRKLEKQPEYKGGNELRDYQLEGLNWLLYSWYKRNN-------------------CILADEMGLGKTVQTIT 408 (1373)
T ss_pred ccCccchhHHHhhcCccccccchhhhhhcccchhHHHHHHhccc-------------------ceehhhcCCCcchHHHH
Confidence 34567778999999999999999999999999999999987765 55666677799999999
Q ss_pred HHHhhhhcCCCCCeEEecCCCchhhHHHHHHhhcCCcEEEEcceeeEEecccchhhhhhhhhhhhhhhccccCCCeEEEe
Q psy14708 88 FVDAVFKTGIRGPFLVIAPLSTIPNWQREFEAWTDLNVIVYHATFVVLLQTGSKFFRICLEFFVDAVFKTGIRGPFLVIA 167 (513)
Q Consensus 88 li~~~~~~~~~~~~liv~P~~~~~~W~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LIv~ 167 (513)
++.++...+ ...||+||||
T Consensus 409 fl~~l~~~~-------------------------------------------------------------~~~gpflvvv 427 (1373)
T KOG0384|consen 409 FLSYLFHSL-------------------------------------------------------------QIHGPFLVVV 427 (1373)
T ss_pred HHHHHHHhh-------------------------------------------------------------hccCCeEEEe
Confidence 998776553 2458999999
Q ss_pred cCCCccchHHHHHhhcCceeEEEeccccchhhhhHHhHhhhhhcccccCCCCccccccCCcccchhhccccccccccchh
Q psy14708 168 PLSTIPNWQREFEAWTDLNVIVYHGRRKKLSRRDKERLRLKYVAADYVPKDGEVLYGNWSRSECFKVERGLLTFGWGRWK 247 (513)
Q Consensus 168 P~sll~qW~~E~~~~~~l~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 247 (513)
|.|++.+|++|+..|+++++++|+|.
T Consensus 428 plst~~~W~~ef~~w~~mn~i~y~g~------------------------------------------------------ 453 (1373)
T KOG0384|consen 428 PLSTITAWEREFETWTDMNVIVYHGN------------------------------------------------------ 453 (1373)
T ss_pred ehhhhHHHHHHHHHHhhhceeeeecc------------------------------------------------------
Confidence 99999999999999999999999998
Q ss_pred hhhcccccccCchhHHHHHHHHHhhhcCCCCCCcCCCCCCCCCCCcchhhhhhhhHhhhhhhccccccccccccccCCcE
Q psy14708 248 EFLANNEFRNGWTEEYVEELARLLDLAGGDGKSFSPTMSSGTDGLKSASASRNMLQEYELFFRNDKNQFIKEKDLYKFHV 327 (513)
Q Consensus 248 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v 327 (513)
..+|..+++|++..... ....+|++
T Consensus 454 ------------------------------------------------~~sr~~i~~ye~~~~~~-------~~~lkf~~ 478 (1373)
T KOG0384|consen 454 ------------------------------------------------LESRQLIRQYEFYHSSN-------TKKLKFNA 478 (1373)
T ss_pred ------------------------------------------------hhHHHHHHHHHheecCC-------ccccccce
Confidence 55677888888776654 23457999
Q ss_pred EEecHHHHHhchhhhccccccEEEEccccccCCcchhHHHHHhhcccccEEEEeCCCCCCCHHHHHHHHhhhCCCCCCCh
Q psy14708 328 LITTFEIIISDCLELKDFNWRLCIIDEAHRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNN 407 (513)
Q Consensus 328 vitt~~~~~~~~~~l~~~~~~~vIvDEaH~~kn~~s~~~~al~~l~a~~r~~LTGTP~~n~~~dl~~ll~~L~~~~~~~~ 407 (513)
+||||+.+..+...|..++|..++|||||++||..+..+..+..++..+|+++||||+||++.|||++++||.|+.|..+
T Consensus 479 lltTye~~LkDk~~L~~i~w~~~~vDeahrLkN~~~~l~~~l~~f~~~~rllitgTPlQNsikEL~sLl~Fl~P~kf~~~ 558 (1373)
T KOG0384|consen 479 LLTTYEIVLKDKAELSKIPWRYLLVDEAHRLKNDESKLYESLNQFKMNHRLLITGTPLQNSLKELWSLLHFLMPGKFDSW 558 (1373)
T ss_pred eehhhHHHhccHhhhccCCcceeeecHHhhcCchHHHHHHHHHHhcccceeeecCCCccccHHHHHHHhcccCCCCCCcH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCcccHHHHHHHHHHHHHHHHHHhHHHHhhcCCCceEEEEEecCCHHHHHHHHHHHHHHhhhhhcCCCCCChh
Q psy14708 408 EAFMSEFGQLKTESEVNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNFSFLSKGTTSANVP 487 (513)
Q Consensus 408 ~~f~~~~~~~~~~~~~~~l~~~l~~~~~rrtk~~v~~~LP~~~~~~i~v~ls~~q~~~Y~~l~~~~~~~l~~~~~~~~~~ 487 (513)
..|...| ...+...+..|+.+|.|+|+||.++||.+.||++.|.++.|+||+.|+.+|+.|+.+++..|.+|..+.+ +
T Consensus 559 ~~f~~~~-~~~~e~~~~~L~~~L~P~~lRr~kkdvekslp~k~E~IlrVels~lQk~yYk~ILtkN~~~LtKG~~g~~-~ 636 (1373)
T KOG0384|consen 559 DEFLEEF-DEETEEQVRKLQQILKPFLLRRLKKDVEKSLPPKEETILRVELSDLQKQYYKAILTKNFSALTKGAKGST-P 636 (1373)
T ss_pred HHHHHhh-cchhHHHHHHHHHHhhHHHHHHHHhhhccCCCCCcceEEEeehhHHHHHHHHHHHHhhHHHHhccCCCCC-c
Confidence 9999999 5567788999999999999999999999999999999999999999999999999999999999998877 8
Q ss_pred HHHHHHHHHHHhcCCCCCcCCCc
Q psy14708 488 NLMNTMMELRKCCIHPYLLNGKT 510 (513)
Q Consensus 488 ~~l~~l~~LRq~c~HP~L~~~~~ 510 (513)
.++++++.||+|||||||+++++
T Consensus 637 ~lLNimmELkKccNHpyLi~gae 659 (1373)
T KOG0384|consen 637 SLLNIMMELKKCCNHPYLIKGAE 659 (1373)
T ss_pred hHHHHHHHHHHhcCCccccCcHH
Confidence 89999999999999999999875
|
|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >KOG1016|consensus | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >KOG1513|consensus | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 513 | ||||
| 3mwy_W | 800 | Crystal Structure Of The Chromodomain-atpase Portio | 4e-30 | ||
| 1z6a_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN | 7e-12 | ||
| 1z63_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM | 2e-11 | ||
| 1z3i_X | 644 | Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA | 3e-06 | ||
| 1z3i_X | 644 | Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA | 2e-04 |
| >pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 | Back alignment and structure |
|
| >pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 | Back alignment and structure |
| >pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 | Back alignment and structure |
| >pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 | Back alignment and structure |
| >pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
Score = 331 bits (851), Expect = e-105
Identities = 85/213 (39%), Positives = 129/213 (60%), Gaps = 5/213 (2%)
Query: 296 SASRNMLQEYELFFRNDKNQFIKEKDLYKFHVLITTFEIIISDCLELKDFNWRLCIIDEA 355
SR+ ++EYE + K K KF+VL+TT+E I+ D EL W+ +DEA
Sbjct: 321 QKSRDTIREYEFYTNPRA----KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEA 376
Query: 356 HRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEFG 415
HRLKN L E L + +R+L++GTPLQNN+ EL +L+NFL P +F+ ++ E
Sbjct: 377 HRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ 436
Query: 416 QLKTESEVNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNFS 475
+ E ++ L ++P +LRRLK+DVEKS+ K E ++ VEL+++Q +YY+ IL +N+S
Sbjct: 437 DEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYS 496
Query: 476 FLSKGTTSANVPNLMNTMMELRKCCIHPYLLNG 508
L+ G +L+N M EL+K HPYL +
Sbjct: 497 ALTAGAKG-GHFSLLNIMNELKKASNHPYLFDN 528
|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 513 | |||
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 100.0 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 100.0 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 100.0 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.94 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.78 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.74 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.68 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.64 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.61 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.56 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.55 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.53 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.51 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.51 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.5 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.47 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.41 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.36 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.35 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.32 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.31 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.3 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.29 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.28 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.28 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.27 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.27 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.26 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.24 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.24 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.23 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.21 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.2 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.18 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.17 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.14 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.11 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.09 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.08 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.07 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.03 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.02 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.01 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 98.98 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 98.96 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 98.96 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 98.92 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 98.91 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 98.87 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 98.85 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 98.85 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 98.84 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 98.79 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 98.77 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 98.76 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 98.74 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 98.73 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 98.72 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 98.7 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 98.69 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 98.6 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 98.26 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 98.07 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 98.06 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 98.06 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 97.97 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 97.89 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.82 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 97.73 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 97.66 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 97.65 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 97.64 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 97.6 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 97.42 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 97.39 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 97.32 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 97.24 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 96.93 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 96.47 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 96.39 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.28 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 96.22 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 96.12 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 96.09 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 95.98 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 95.94 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.41 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 95.07 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 95.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 94.78 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 94.45 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 94.31 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 94.17 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 94.13 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 93.87 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 93.74 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 93.42 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 92.97 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 91.58 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 91.43 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 89.68 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 89.51 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 88.99 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 88.76 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 88.19 |
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.2e-45 Score=409.36 Aligned_cols=308 Identities=42% Similarity=0.751 Sum_probs=234.3
Q ss_pred CCccccCCCCccCCccchhhHHhhHHHHHhhhcCCccccccccCCCCcchhhhhhcccccccCCCCchhhHHHHHHhhhh
Q psy14708 15 DWVKLEKSPVYKNDNTLRAYQLEGLNWLMFSWFNGRNCILADEMGLGKTIQSLTRNCILADEMGLGKTIQSLTFVDAVFK 94 (513)
Q Consensus 15 ~~~~~~~~p~~~~~~~Lrp~Q~~~v~~m~~~~~~~~~~~l~~e~g~gkt~~~~~~GgiLademGlGKT~~~iali~~~~~ 94 (513)
.+..+..+|.+..+.+|||||++||.||+..+.++ +||||||+||+|||+++|+++..+..
T Consensus 221 ~~~~~~~~p~~~~~~~Lr~yQ~egv~~l~~~~~~~-------------------~~~ILademGlGKT~~ai~~i~~l~~ 281 (800)
T 3mwy_W 221 RFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKG-------------------DNGILADEMGLGKTVQTVAFISWLIF 281 (800)
T ss_dssp CCCCCSSCCTTCCSSCCCTHHHHHHHHHHHHHTTT-------------------CCEEECCCTTSSTTHHHHHHHHHHHH
T ss_pred cccccccCCCccCCCCcCHHHHHHHHHHHHHhhcC-------------------CCEEEEeCCCcchHHHHHHHHHHHHH
Confidence 36667778888778899999999999998666543 34888999999999999999876643
Q ss_pred cCCCCCeEEecCCCchhhHHHHHHhhcCCcEEEEcceeeEEecccchhhhhhhhhhhhhhhccccCCCeEEEecCCCccc
Q psy14708 95 TGIRGPFLVIAPLSTIPNWQREFEAWTDLNVIVYHATFVVLLQTGSKFFRICLEFFVDAVFKTGIRGPFLVIAPLSTIPN 174 (513)
Q Consensus 95 ~~~~~~~liv~P~~~~~~W~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LIv~P~sll~q 174 (513)
.+ ...+|+|||||.+++.|
T Consensus 282 ~~-------------------------------------------------------------~~~~~~LIV~P~sll~q 300 (800)
T 3mwy_W 282 AR-------------------------------------------------------------RQNGPHIIVVPLSTMPA 300 (800)
T ss_dssp HH-------------------------------------------------------------SCCSCEEEECCTTTHHH
T ss_pred hc-------------------------------------------------------------CCCCCEEEEECchHHHH
Confidence 21 12356677777777777
Q ss_pred hHHHHHhhc-CceeEEEeccccchhhhhHHhHhhhhhcccccCCCCccccccCCcccchhhccccccccccchhhhhccc
Q psy14708 175 WQREFEAWT-DLNVIVYHGRRKKLSRRDKERLRLKYVAADYVPKDGEVLYGNWSRSECFKVERGLLTFGWGRWKEFLANN 253 (513)
Q Consensus 175 W~~E~~~~~-~l~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 253 (513)
|.+|+.+|+ ++++++|+|....+....
T Consensus 301 W~~E~~~~~p~~~v~~~~g~~~~r~~~~---------------------------------------------------- 328 (800)
T 3mwy_W 301 WLDTFEKWAPDLNCICYMGNQKSRDTIR---------------------------------------------------- 328 (800)
T ss_dssp HHHHHHHHSTTCCEEECCCSSHHHHHHH----------------------------------------------------
T ss_pred HHHHHHHHCCCceEEEEeCCHHHHHHHH----------------------------------------------------
Confidence 777777776 788888988754321111
Q ss_pred ccccCchhHHHHHHHHHhhhcCCCCCCcCCCCCCCCCCCcchhhhhhhhHhhhhhhccccccccccccccCCcEEEecHH
Q psy14708 254 EFRNGWTEEYVEELARLLDLAGGDGKSFSPTMSSGTDGLKSASASRNMLQEYELFFRNDKNQFIKEKDLYKFHVLITTFE 333 (513)
Q Consensus 254 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvitt~~ 333 (513)
.+++..... ........++|++|||+
T Consensus 329 --------------------------------------------------~~~~~~~~~----~~~~~~~~~dvvitTy~ 354 (800)
T 3mwy_W 329 --------------------------------------------------EYEFYTNPR----AKGKKTMKFNVLLTTYE 354 (800)
T ss_dssp --------------------------------------------------HHHSCSCC---------CCCCCSEEEECTT
T ss_pred --------------------------------------------------HHHhhcccc----ccccccccCCEEEecHH
Confidence 000000000 01123457899999999
Q ss_pred HHHhchhhhccccccEEEEccccccCCcchhHHHHHhhcccccEEEEeCCCCCCCHHHHHHHHhhhCCCCCCChHHHHHH
Q psy14708 334 IIISDCLELKDFNWRLCIIDEAHRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSE 413 (513)
Q Consensus 334 ~~~~~~~~l~~~~~~~vIvDEaH~~kn~~s~~~~al~~l~a~~r~~LTGTP~~n~~~dl~~ll~~L~~~~~~~~~~f~~~ 413 (513)
.+..+...+..++|++||+||||++||.++..++++..+++.+||+|||||++|++.|||++++||.|+.|.....|.-.
T Consensus 355 ~l~~~~~~l~~~~w~~vIvDEaH~lkn~~s~~~~~l~~l~~~~rl~LTgTPiqN~l~el~~ll~fL~p~~~~~~~~~~~~ 434 (800)
T 3mwy_W 355 YILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFE 434 (800)
T ss_dssp HHHHTHHHHHTSEEEEEEETTGGGGCCSSSHHHHHHTTSEEEEEEEECSCCCSSCSHHHHHHHHHHCSCCC---------
T ss_pred HHHhhHHHHhcCCcceeehhhhhhhcCchhHHHHHHHHhhhccEEEeeCCcCCCCHHHHHHHHHHhCccccCchhhhccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999876666544
Q ss_pred hcCcccHHHHHHHHHHHHHHHHHHhHHHHhhcCCCceEEEEEecCCHHHHHHHHHHHHHHhhhhhcCCCCCChhHHHHHH
Q psy14708 414 FGQLKTESEVNKLQLLLKPMMLRRLKEDVEKSIAPKEETVVEVELTNIQKKYYRGILERNFSFLSKGTTSANVPNLMNTM 493 (513)
Q Consensus 414 ~~~~~~~~~~~~l~~~l~~~~~rrtk~~v~~~LP~~~~~~i~v~ls~~q~~~Y~~l~~~~~~~l~~~~~~~~~~~~l~~l 493 (513)
............|+.+++++++||++.++..+||++.+.++.|+||+.|+++|+.++.+....+..+... ....+++.+
T Consensus 435 ~~~~~~~~~~~~L~~~l~p~~lRR~k~dv~~~LP~k~~~~v~v~ls~~q~~~Y~~i~~~~~~~l~~~~~~-~~~~~l~~l 513 (800)
T 3mwy_W 435 NQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKG-GHFSLLNIM 513 (800)
T ss_dssp CCTTHHHHHHHHHHHTTGGGEEECCGGGGTTTSCCEEEEEEEECCCHHHHHHHHHHHHHCCC-----------CTHHHHH
T ss_pred ccchhHHHHHHHHHHHHhHHHhhhhHHhhhhccCCcEEEEEEeCCCHHHHHHHHHHHHHHHHHHhhcccc-chhhHHHHH
Confidence 3333445567889999999999999999999999999999999999999999999998876665544332 335688999
Q ss_pred HHHHHhcCCCCCcCCC
Q psy14708 494 MELRKCCIHPYLLNGK 509 (513)
Q Consensus 494 ~~LRq~c~HP~L~~~~ 509 (513)
++||++|+||+|+.+.
T Consensus 514 ~~Lrk~~~hp~l~~~~ 529 (800)
T 3mwy_W 514 NELKKASNHPYLFDNA 529 (800)
T ss_dssp HHHHHHHHCGGGSSSH
T ss_pred HHHHHHhcChhhhcch
Confidence 9999999999998653
|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 513 | ||||
| d1z63a1 | 230 | c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h | 1e-16 | |
| d1z63a1 | 230 | c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h | 1e-13 | |
| d1z3ix1 | 346 | c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi | 5e-13 | |
| d1z3ix2 | 298 | c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis | 2e-12 | |
| d1z3ix2 | 298 | c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis | 3e-12 | |
| d1z5za1 | 244 | c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h | 9e-09 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 4e-06 | |
| d2fz4a1 | 206 | c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc | 3e-05 | |
| d2fz4a1 | 206 | c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc | 0.001 |
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Helicase of the SNF2/Rad54 hamily species: Sulfolobus solfataricus [TaxId: 2287]
Score = 77.0 bits (188), Expect = 1e-16
Identities = 37/133 (27%), Positives = 76/133 (57%), Gaps = 4/133 (3%)
Query: 314 NQFIKEKDLYKFHVLITTFEIIISDCLELKDFNWRLCIIDEAHRLKNRNCKLLEGLRLLH 373
++ + L + +++TT+ +++ D LK+ W+ +IDEA +KN K+ + ++ L
Sbjct: 93 HEDRSKIKLEDYDIILTTYAVLLRDT-RLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELK 151
Query: 374 LEHRVLLSGTPLQNNVNELFSLLNFLEPQQFSNNEAFMSEFGQLKTESE---VNKLQLLL 430
++R+ L+GTP++N V++L+S++ FL P + F S+F + + +L+ ++
Sbjct: 152 SKYRIALTGTPIENKVDDLWSIMTFLNPGLLGSYSEFKSKFATPIKKGDNMAKEELKAII 211
Query: 431 KPMMLRRLKEDVE 443
P +LRR K D
Sbjct: 212 SPFILRRTKYDKA 224
|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 513 | |||
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 100.0 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 100.0 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.8 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.67 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.56 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.28 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.19 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.17 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.07 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.85 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 98.82 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.75 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 98.63 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 98.56 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 98.46 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 98.43 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 98.28 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 98.19 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 98.17 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 98.13 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 98.11 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.02 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 97.88 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 97.81 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 97.68 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.37 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 90.42 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 87.77 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 87.52 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 86.3 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 84.03 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 83.09 |
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Helicase of the SNF2/Rad54 hamily species: Sulfolobus solfataricus [TaxId: 2287]
Probab=100.00 E-value=3.1e-41 Score=320.06 Aligned_cols=124 Identities=29% Similarity=0.648 Sum_probs=111.6
Q ss_pred cCCcEEEecHHHHHhchhhhccccccEEEEccccccCCcchhHHHHHhhcccccEEEEeCCCCCCCHHHHHHHHhhhCCC
Q psy14708 323 YKFHVLITTFEIIISDCLELKDFNWRLCIIDEAHRLKNRNCKLLEGLRLLHLEHRVLLSGTPLQNNVNELFSLLNFLEPQ 402 (513)
Q Consensus 323 ~~~~vvitt~~~~~~~~~~l~~~~~~~vIvDEaH~~kn~~s~~~~al~~l~a~~r~~LTGTP~~n~~~dl~~ll~~L~~~ 402 (513)
.++++++++|+.+.... .+..++|++||+||+|++||..+..++++..+++++||+|||||++|++.|+|++++||+|+
T Consensus 102 ~~~~vvi~~~~~~~~~~-~l~~~~~~~vI~DEah~~k~~~s~~~~~~~~l~a~~r~~LTgTPi~n~~~dl~~ll~~l~p~ 180 (230)
T d1z63a1 102 EDYDIILTTYAVLLRDT-RLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKVDDLWSIMTFLNPG 180 (230)
T ss_dssp GGSSEEEEEHHHHTTCH-HHHTCCEEEEEEETGGGGSCTTSHHHHHHHTSCEEEEEEECSSCSTTCHHHHHHHHHHHSTT
T ss_pred cCcCEEEeeHHHHHhHH-HHhcccceEEEEEhhhcccccchhhhhhhhhhccceEEEEecchHHhHHHHHHHHHHhhCCC
Confidence 45689999999997754 47788999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCChHHHHHHhcCc---ccHHHHHHHHHHHHHHHHHHhHHH--HhhcCC
Q psy14708 403 QFSNNEAFMSEFGQL---KTESEVNKLQLLLKPMMLRRLKED--VEKSIA 447 (513)
Q Consensus 403 ~~~~~~~f~~~~~~~---~~~~~~~~l~~~l~~~~~rrtk~~--v~~~LP 447 (513)
.+++...|.+.|..+ .+....++|+.++++||+||+|+| |..+||
T Consensus 181 ~~~~~~~F~~~~~~~~~~~~~~~~~~L~~~l~~~~lRr~K~d~~v~~dLP 230 (230)
T d1z63a1 181 LLGSYSEFKSKFATPIKKGDNMAKEELKAIISPFILRRTKYDKAIINDLP 230 (230)
T ss_dssp TTCCHHHHHTTTHHHHHTTCHHHHHHHHHHHTTTEECCCTTCHHHHTTSC
T ss_pred cCCCHHHHHHHHhhhhhccCHHHHHHHHHHhhccEEEEecCCccHhhcCC
Confidence 999999999988643 345567789999999999999998 567888
|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|