Diaphorina citri psyllid: psy14754

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIKELNKMKQEPVKPEEGRAMAQKINAFAYLECSAKSKEGVREVFETATRAALQVKKKKKGRCRLL

cccccccEEEEcccccccEEEHHHHcccccccccccccccccEEEEEEccEEEEEEcEEcccccccccccccccccccEEEEEEEcccccccccccccccHHHHHHcccccEEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHccccccccccEEc

**AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTI**********VKPEEGRAMAQKINAFAYLECSAKSKEGVREVFETATRA***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIKELNKMKQEPVKPEEGRAMAQKINAFAYLECSAKSKEGVREVFETATRAALQVKKKKKGRCRLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ras-like GTP-binding protein Rho1	Has a role in regulating actin cytoskeletal organization: required during early development for proper execution of morphogenetic movements of individual cells and groups of cells important for the formation of the embryonic body plan. Plays a role in regulating dorsal closure during embryogenesis. May have a role in eye development.	very confident	P48148
Rho-related GTP-binding protein RhoC	Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.	very confident	Q9PSX7
GTP-binding protein rho1	Involved in the regulation of cell wall growth and actin cytoskeleton organization. Activates (1,3)-beta-D-glucan synthase.	very confident	Q09914

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051493 [BP]	regulation of cytoskeleton organization	very confident	GO:0033043, GO:0051128, GO:0008150, GO:0065007, GO:0050794, GO:0050789
GO:0007165 [BP]	signal transduction	very confident	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]	cytosol	very confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005938 [CC]	cell cortex	very confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0043168 [MF]	anion binding	very confident	GO:0003674, GO:0005488, GO:0043167
GO:0005886 [CC]	plasma membrane	very confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0032154 [CC]	cleavage furrow	very confident	GO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0005634 [CC]	nucleus	very confident	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0070451 [CC]	cell hair	very confident	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0032550 [MF]	purine ribonucleoside binding	very confident	GO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:0032549, GO:1901363, GO:0001883, GO:0001882
GO:0032561 [MF]	guanyl ribonucleotide binding	very confident	GO:0097159, GO:0000166, GO:0036094, GO:0019001, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:1901363, GO:1901265, GO:0005488
GO:0022607 [BP]	cellular component assembly	very confident	GO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0051496 [BP]	positive regulation of stress fiber assembly	confident	GO:0051130, GO:0032231, GO:0032233, GO:0033043, GO:0051493, GO:0051495, GO:0032970, GO:0010638, GO:0051492, GO:0050794, GO:0044087, GO:0065007, GO:0032956, GO:0048518, GO:0008150, GO:0051128, GO:0050789, GO:0048522
GO:0043149 [BP]	stress fiber assembly	confident	GO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0051017, GO:0016043, GO:0044085, GO:0044763, GO:0030036, GO:0008150, GO:0071840
GO:0048813 [BP]	dendrite morphogenesis	confident	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0006974 [BP]	response to DNA damage stimulus	confident	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0007405 [BP]	neuroblast proliferation	confident	GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0008283, GO:0009987, GO:0048869, GO:0030154, GO:0044763, GO:0007275, GO:0032501, GO:0008150, GO:0061351, GO:0048731, GO:0022008, GO:0072089, GO:0044699
GO:0008354 [BP]	germ cell migration	confident	GO:0040011, GO:0044702, GO:0051674, GO:0048609, GO:0032504, GO:0048870, GO:0032501, GO:0009987, GO:0019953, GO:0006928, GO:0022414, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0016477, GO:0051179, GO:0007276, GO:0000003
GO:0007160 [BP]	cell-matrix adhesion	confident	GO:0031589, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0007368 [BP]	determination of left/right symmetry	confident	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699
GO:0046664 [BP]	dorsal closure, amnioserosa morphology change	confident	GO:0048598, GO:0032502, GO:0001700, GO:0060429, GO:0044707, GO:0002009, GO:0032501, GO:0048856, GO:0009888, GO:0007391, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0044699, GO:0048729, GO:0009653, GO:0007275, GO:0016331
GO:0046663 [BP]	dorsal closure, leading edge cell differentiation	confident	GO:0048598, GO:0016331, GO:0030154, GO:0009790, GO:0035026, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0001700, GO:0048869, GO:0048729, GO:0030855, GO:0032502, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0044707, GO:0048856, GO:0007392, GO:0007391, GO:0044763, GO:0009987
GO:0007374 [BP]	posterior midgut invagination	confident	GO:0048598, GO:0002009, GO:0007369, GO:0060571, GO:0044707, GO:0001703, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0009790, GO:0010004, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699, GO:0048856
GO:0008347 [BP]	glial cell migration	confident	GO:0040011, GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0042063, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0007173 [BP]	epidermal growth factor receptor signaling pathway	confident	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0035159 [BP]	regulation of tube length, open tracheal system	confident	GO:0035150, GO:0035151, GO:0035152, GO:0032501, GO:0044707, GO:0007424, GO:0060541, GO:0048856, GO:0090066, GO:0032502, GO:0065007, GO:0048731, GO:0008150, GO:0065008, GO:0007275, GO:0044699
GO:0005935 [CC]	cellular bud neck	confident	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005934 [CC]	cellular bud tip	confident	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0001745 [BP]	compound eye morphogenesis	confident	GO:0048749, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048592, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0007519 [BP]	skeletal muscle tissue development	confident	GO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0044767, GO:0061061, GO:0014706, GO:0048513, GO:0008150, GO:0060537, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0030866 [BP]	cortical actin cytoskeleton organization	confident	GO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030865, GO:0044763, GO:0030036, GO:0008150, GO:0044699, GO:0016043
GO:0035147 [BP]	branch fusion, open tracheal system	confident	GO:0035146, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0060541, GO:0032501, GO:0035239, GO:0060446, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0007424, GO:0044707, GO:0048856, GO:0032502, GO:0048731
GO:0004871 [MF]	signal transducer activity	confident	GO:0060089, GO:0003674
GO:0036089 [BP]	cleavage furrow formation	confident	GO:0000910, GO:0044699, GO:0032506, GO:0009987, GO:0008150, GO:0022402, GO:0051301, GO:0044763, GO:0007049
GO:0090254 [BP]	cell elongation involved in imaginal disc-derived wing morphogenesis	confident	GO:0048563, GO:0048589, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0009826, GO:0016049, GO:0000902, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0032989, GO:0048513, GO:0071840, GO:0060560, GO:0032502, GO:0048707, GO:0009886, GO:0009987, GO:0035114, GO:0044763, GO:0048731, GO:0040007, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0008150, GO:0048736, GO:0048737
GO:0030027 [CC]	lamellipodium	confident	GO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0035298 [BP]	regulation of Malpighian tubule size	confident	GO:0048598, GO:0061326, GO:0048619, GO:0055123, GO:0009790, GO:0048565, GO:0009653, GO:0072001, GO:0044699, GO:0002009, GO:0090066, GO:0048513, GO:0065007, GO:0048729, GO:0060562, GO:0065008, GO:0035150, GO:0061333, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0061525, GO:0008150, GO:0001655, GO:0072002, GO:0035295, GO:0007443, GO:0007442, GO:0044707, GO:0048856, GO:0032502, GO:0007275, GO:0048731, GO:0048546
GO:0000148 [CC]	1,3-beta-D-glucan synthase complex	confident	GO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0006927 [BP]	transformed cell apoptotic process	confident	GO:0010259, GO:0009987, GO:0006915, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0097285, GO:0044699
GO:0019904 [MF]	protein domain specific binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0005525 [MF]	GTP binding	confident	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0007422 [BP]	peripheral nervous system development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0030838 [BP]	positive regulation of actin filament polymerization	confident	GO:0033043, GO:0051128, GO:0008064, GO:0071840, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0051495, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0065008, GO:0051130, GO:0009987, GO:0032970, GO:0031334, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0010638, GO:0044087, GO:0008150, GO:0032535, GO:0048522
GO:0030589 [BP]	pseudocleavage involved in syncytial blastoderm formation	confident	GO:0032502, GO:0001700, GO:0032501, GO:0044707, GO:0030588, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0000131 [CC]	incipient cellular bud site	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008333 [BP]	endosome to lysosome transport	confident	GO:0016197, GO:0051234, GO:0046907, GO:0007034, GO:0006810, GO:0044765, GO:0008150, GO:0007041, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0035277 [BP]	spiracle morphogenesis, open tracheal system	confident	GO:0032502, GO:0007424, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0043332 [CC]	mating projection tip	confident	GO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0009898 [CC]	internal side of plasma membrane	confident	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0035099 [BP]	hemocyte migration	confident	GO:0048568, GO:0006928, GO:0009790, GO:0051674, GO:0007275, GO:0044699, GO:0048513, GO:0048534, GO:0016477, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0035162, GO:0051179, GO:0002520, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0030097, GO:0002376, GO:0008150
GO:0000935 [CC]	barrier septum	confident	GO:0005575, GO:0030428, GO:0044464, GO:0005623
GO:0016203 [BP]	muscle attachment	confident	GO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0061061, GO:0048513, GO:0008150, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0033144 [BP]	negative regulation of intracellular steroid hormone receptor signaling pathway	confident	GO:0009968, GO:0033143, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0007266 [BP]	Rho protein signal transduction	confident	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699
GO:0005741 [CC]	mitochondrial outer membrane	confident	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0007298 [BP]	border follicle cell migration	confident	GO:0048610, GO:0048870, GO:0030154, GO:0048468, GO:0019953, GO:0006928, GO:0007292, GO:0051674, GO:0007297, GO:0001667, GO:0044699, GO:0000003, GO:0048869, GO:0030707, GO:0051179, GO:0007276, GO:0016477, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0090132, GO:0090130, GO:0040011, GO:0044702, GO:0010631, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0001737 [BP]	establishment of imaginal disc-derived wing hair orientation	confident	GO:0048563, GO:0030030, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0007164, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0002009, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0035317, GO:0048569, GO:0048513, GO:0071840, GO:0048729, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0060429, GO:0009888, GO:0035114, GO:0001738, GO:0008150, GO:0048731, GO:0022008, GO:0001736, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0044763, GO:0009987, GO:0048736, GO:0048737
GO:0030521 [BP]	androgen receptor signaling pathway	confident	GO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0030518, GO:0007154, GO:0050789, GO:0044699
GO:0003924 [MF]	GTPase activity	confident	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0070593 [BP]	dendrite self-avoidance	confident	GO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0033205 []	cell cycle cytokinesis	confident
GO:0007377 [BP]	germ-band extension	confident	GO:0048598, GO:0001703, GO:0048856, GO:0044707, GO:0032501, GO:0007369, GO:0044767, GO:0009790, GO:0010004, GO:0008150, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0007370 [BP]	ventral furrow formation	confident	GO:0032502, GO:0001703, GO:0048856, GO:0044707, GO:0032501, GO:0007369, GO:0044767, GO:0009790, GO:0010004, GO:0008150, GO:0048646, GO:0048598, GO:0009653, GO:0007275, GO:0044699
GO:0019003 [MF]	GDP binding	confident	GO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0071479 [BP]	cellular response to ionizing radiation	confident	GO:0009628, GO:0051716, GO:0071478, GO:0010212, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0071214, GO:0044699
GO:0070301 [BP]	cellular response to hydrogen peroxide	confident	GO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0042542, GO:0050896, GO:0009987, GO:0034614, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:0044699
GO:0032587 [CC]	ruffle membrane	confident	GO:0001726, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0043296 [CC]	apical junction complex	confident	GO:0005575, GO:0030054, GO:0005911
GO:0043297 [BP]	apical junction assembly	confident	GO:0022607, GO:0034330, GO:0016043, GO:0008150, GO:0044085, GO:0007043, GO:0071840, GO:0045216, GO:0044763, GO:0009987, GO:0034329, GO:0044699
GO:0043123 [BP]	positive regulation of I-kappaB kinase/NF-kappaB cascade	confident	GO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043122, GO:0048522
GO:0006184 [BP]	GTP catabolic process	confident	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0030424 [CC]	axon	confident	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045199 [BP]	maintenance of epithelial cell apical/basal polarity	confident	GO:0035088, GO:0061245, GO:0035090, GO:0009987, GO:0045197, GO:0007163, GO:0044763, GO:0030011, GO:0008150, GO:0044699
GO:0007395 [BP]	dorsal closure, spreading of leading edge cells	confident	GO:0032502, GO:0016331, GO:0006928, GO:0009790, GO:0051674, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0001700, GO:0048729, GO:0016477, GO:0048598, GO:0009987, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0051179, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0007391, GO:0009792, GO:0044763
GO:0007435 [BP]	salivary gland morphogenesis	confident	GO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0007431, GO:0048856, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699
GO:0051656 [BP]	establishment of organelle localization	confident	GO:0009987, GO:0044763, GO:0044699, GO:0008150, GO:0051234, GO:0051179, GO:0051640, GO:0051641
GO:0051491 [BP]	positive regulation of filopodium assembly	confident	GO:0051130, GO:0051489, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:0045665 [BP]	negative regulation of neuron differentiation	confident	GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0045666 [BP]	positive regulation of neuron differentiation	confident	GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0035838 [CC]	growing cell tip	confident	GO:0060187, GO:0051286, GO:0030427, GO:0044464, GO:0005623, GO:0005575
GO:0030448 [BP]	hyphal growth	confident	GO:0030447, GO:0008150, GO:0040007, GO:0044699
GO:0002119 [BP]	nematode larval development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0060263 [BP]	regulation of respiratory burst	confident	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0043931 [BP]	ossification involved in bone maturation	confident	GO:0032502, GO:0032501, GO:0070977, GO:0044707, GO:0048856, GO:0060348, GO:0044767, GO:0001501, GO:0001503, GO:0008150, GO:0044699, GO:0048731, GO:0010259, GO:0007275, GO:0071695
GO:0045471 [BP]	response to ethanol	confident	GO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0040028 [BP]	regulation of vulval development	confident	GO:0050793, GO:0048580, GO:0008150, GO:2000026, GO:0051239, GO:0065007, GO:0061062, GO:0050789
GO:0007179 [BP]	transforming growth factor beta receptor signaling pathway	confident	GO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0045727 [BP]	positive regulation of translation	confident	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0017022 [MF]	myosin binding	confident	GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030010 [BP]	establishment of cell polarity	confident	GO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030241 [BP]	skeletal muscle myosin thick filament assembly	confident	GO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0034622, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0071688, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0014866, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0030154, GO:0044763, GO:0009987, GO:0042692
GO:0017157 [BP]	regulation of exocytosis	confident	GO:0051046, GO:0060341, GO:0051049, GO:0050794, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0030496 [CC]	midbody	confident	GO:0005575, GO:0044464, GO:0005623
GO:0014057 [BP]	positive regulation of acetylcholine secretion	confident	GO:0060341, GO:0051047, GO:0051049, GO:0050804, GO:0014056, GO:0023051, GO:0051588, GO:0010646, GO:0050789, GO:0043269, GO:0051046, GO:0044057, GO:0065007, GO:0048518, GO:0051954, GO:0051050, GO:0050794, GO:0043270, GO:0051952, GO:0051590, GO:0046928, GO:0008150, GO:0051239, GO:0032879, GO:0031644, GO:0001956, GO:0051969, GO:0048522
GO:0030728 [BP]	ovulation	confident	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0007276, GO:0044699, GO:0000003
GO:0031521 [CC]	spitzenkorper	confident	GO:0043234, GO:0032991, GO:0030427, GO:0001411, GO:0044464, GO:0005623, GO:0005575
GO:0045121 [CC]	membrane raft	confident	GO:0005575, GO:0044425, GO:0016020
GO:0040039 [BP]	inductive cell migration	confident	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0016477, GO:0051179, GO:0044699
GO:0046847 [BP]	filopodium assembly	confident	GO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0008406 [BP]	gonad development	confident	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0045137, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031562 [CC]	hyphal tip polarisome	confident	GO:0043234, GO:0005737, GO:0032991, GO:0000133, GO:0044464, GO:0001411, GO:0030427, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0071777 []	positive regulation of cell cycle cytokinesis	confident
GO:0050807 [BP]	regulation of synapse organization	confident	GO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050803, GO:0050877, GO:0009987, GO:0044763, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0065008, GO:0050789, GO:0044699, GO:0003008
GO:0051924 [BP]	regulation of calcium ion transport	confident	GO:0051049, GO:0010959, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0060635 [BP]	positive regulation of (1->3)-beta-D-glucan biosynthetic process	confident	GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0032885, GO:0050789, GO:0010962, GO:0080090, GO:0010604, GO:0031328, GO:2000112, GO:0065007, GO:0032881, GO:0045913, GO:0060255, GO:0009889, GO:0050794, GO:0032951, GO:0032950, GO:0032953, GO:0032952, GO:0008150, GO:0010675, GO:0010676, GO:0043255, GO:0010557, GO:0010556, GO:0048518, GO:0006109, GO:0048522
GO:0048840 [BP]	otolith development	confident	GO:0032502, GO:0048839, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0007275, GO:0044699
GO:0006972 [BP]	hyperosmotic response	confident	GO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0001666 [BP]	response to hypoxia	confident	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0008361 [BP]	regulation of cell size	confident	GO:0071840, GO:0009987, GO:0016043, GO:0090066, GO:0065007, GO:0044763, GO:0032535, GO:0008150, GO:0065008, GO:0044699
GO:0016601 [BP]	Rac protein signal transduction	confident	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699
GO:0032707 [BP]	negative regulation of interleukin-23 production	confident	GO:0051241, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0032667, GO:0048519, GO:0050789, GO:0001818
GO:0045740 [BP]	positive regulation of DNA replication	confident	GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0031328, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0045935, GO:0051052, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0006275, GO:0010557, GO:0010556, GO:0048522
GO:0030032 [BP]	lamellipodium assembly	confident	GO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0031274 [BP]	positive regulation of pseudopodium assembly	confident	GO:0051130, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0031272, GO:0048518, GO:0008150, GO:0048522, GO:0031344, GO:0050794, GO:0031346
GO:0048675 [BP]	axon extension	confident	GO:0032502, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0031505 [BP]	fungal-type cell wall organization	confident	GO:0008150, GO:0009987, GO:0016043, GO:0071554, GO:0071555, GO:0044763, GO:0044699, GO:0045229, GO:0071840, GO:0071852
GO:0002831 [BP]	regulation of response to biotic stimulus	confident	GO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0036342 [BP]	post-anal tail morphogenesis	confident	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0051233 [CC]	spindle midzone	confident	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0007229 [BP]	integrin-mediated signaling pathway	confident	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0019897 [CC]	extrinsic to plasma membrane	confident	GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0032889 [BP]	regulation of vacuole fusion, non-autophagic	confident	GO:0033043, GO:0051128, GO:0065007, GO:0008150, GO:0050794, GO:0050789, GO:0044088
GO:0071803 [BP]	positive regulation of podosome assembly	confident	GO:0051130, GO:0071801, GO:0033043, GO:0031334, GO:0051128, GO:0044087, GO:0065007, GO:1902115, GO:1902117, GO:0048518, GO:0008150, GO:0043254, GO:0050794, GO:0050789, GO:0048522
GO:0031996 [MF]	thioesterase binding	confident	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0045807 [BP]	positive regulation of endocytosis	confident	GO:0051130, GO:0032879, GO:0051050, GO:0051049, GO:0060627, GO:0065007, GO:0048518, GO:0008150, GO:0051128, GO:0030100, GO:0050789, GO:0050794, GO:0048522
GO:0060583 [BP]	regulation of actin cortical patch localization	confident	GO:0060341, GO:0050794, GO:0008150, GO:0065007, GO:0032879, GO:0050789
GO:0060326 [BP]	cell chemotaxis	confident	GO:0040011, GO:0051716, GO:0006935, GO:0042330, GO:0048870, GO:0050896, GO:0009987, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0070887, GO:0042221, GO:0051179, GO:0016477, GO:0009605, GO:0044699
GO:0006075 [BP]	(1->3)-beta-D-glucan biosynthetic process	confident	GO:0044249, GO:0009250, GO:0034645, GO:0016051, GO:1901576, GO:0044264, GO:0044262, GO:0044260, GO:0071704, GO:0006074, GO:0006073, GO:0044042, GO:0043170, GO:0009987, GO:0000271, GO:0034637, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0044723, GO:0051273, GO:0044238, GO:0005975, GO:0051274, GO:0005976, GO:0044237, GO:0033692
GO:0045335 [CC]	phagocytic vesicle	confident	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0007254 [BP]	JNK cascade	confident	GO:0065007, GO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0000165, GO:0031098, GO:0050794, GO:0008150, GO:0006950, GO:0051403, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0044182 [BP]	filamentous growth of a population of unicellular organisms	confident	GO:0030447, GO:0008150, GO:0040007, GO:0044699
GO:0045766 [BP]	positive regulation of angiogenesis	confident	GO:0022603, GO:0050793, GO:0051094, GO:0045765, GO:0008150, GO:1901342, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0045907 [BP]	positive regulation of vasoconstriction	confident	GO:0044057, GO:0051240, GO:0019229, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789
GO:0031965 [CC]	nuclear membrane	confident	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030168 [BP]	platelet activation	confident	GO:0009987, GO:0007599, GO:0050878, GO:0044707, GO:0006950, GO:0032501, GO:0007596, GO:0009611, GO:0042060, GO:0065007, GO:0001775, GO:0050817, GO:0044763, GO:0008150, GO:0065008, GO:0050896, GO:0044699
GO:0060178 [BP]	regulation of exocyst localization	confident	GO:0060341, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0032880
GO:0048471 [CC]	perinuclear region of cytoplasm	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045165 [BP]	cell fate commitment	confident	GO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0000139 [CC]	Golgi membrane	confident	GO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001891 [CC]	phagocytic cup	confident	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0015031 [BP]	protein transport	confident	GO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0043200 [BP]	response to amino acid stimulus	confident	GO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0001101, GO:0042221, GO:1901698
GO:0046330 [BP]	positive regulation of JNK cascade	confident	GO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0046328, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043408, GO:0009966, GO:0009967, GO:0065007, GO:0048518, GO:0010740, GO:0070302, GO:0070304, GO:0050794, GO:0043410, GO:0008150, GO:0032874, GO:0032872, GO:0080134, GO:0080135, GO:0048522
GO:0009894 [BP]	regulation of catabolic process	confident	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0030175 [CC]	filopodium	confident	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0002684 [BP]	positive regulation of immune system process	confident	GO:0048518, GO:0065007, GO:0002682, GO:0050789, GO:0008150
GO:0043025 [CC]	neuronal cell body	confident	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0035011 [BP]	melanotic encapsulation of foreign target	confident	GO:0035006, GO:1901360, GO:0044710, GO:0042440, GO:0071704, GO:0006582, GO:0045087, GO:0019748, GO:0006725, GO:0006952, GO:0035010, GO:0006950, GO:0008150, GO:0008152, GO:0006955, GO:0018958, GO:0050896, GO:0044237, GO:0002376, GO:0002252, GO:0009987, GO:1901615
GO:0045177 [CC]	apical part of cell	confident	GO:0005575, GO:0044464, GO:0005623
GO:0009524 [CC]	phragmoplast	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034446 [BP]	substrate adhesion-dependent cell spreading	confident	GO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0043524 [BP]	negative regulation of neuron apoptotic process	confident	GO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0043525 [BP]	positive regulation of neuron apoptotic process	confident	GO:0050789, GO:0050794, GO:0043065, GO:0010942, GO:0043067, GO:0043523, GO:0065007, GO:0048518, GO:1901216, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0016028 [CC]	rhabdomere	confident	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0045786 [BP]	negative regulation of cell cycle	confident	GO:0051726, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0045785 [BP]	positive regulation of cell adhesion	confident	GO:0030155, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016021 [CC]	integral to membrane	confident	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0008045 [BP]	motor neuron axon guidance	confident	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0031941 [CC]	filamentous actin	confident	GO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030141 [CC]	secretory granule	confident	GO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0009405 [BP]	pathogenesis	confident	GO:0008150, GO:0051704
GO:0051384 [BP]	response to glucocorticoid stimulus	confident	GO:0009719, GO:0033993, GO:0031960, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0001525 [BP]	angiogenesis	confident	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0043652 [BP]	engulfment of apoptotic cell	confident	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0006911, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0043277, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0000920 [BP]	cytokinetic cell separation	confident	GO:0000910, GO:0044699, GO:0032506, GO:0009987, GO:0008150, GO:0022402, GO:0051301, GO:0044763, GO:0007049
GO:0019901 [MF]	protein kinase binding	confident	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0016055 [BP]	Wnt receptor signaling pathway	confident	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0002433 [BP]	immune response-regulating cell surface receptor signaling pathway involved in phagocytosis	confident	GO:0006897, GO:0016192, GO:0006810, GO:0002376, GO:0044765, GO:0008150, GO:0002252, GO:0006909, GO:0051234, GO:0051179, GO:0044699
GO:0000329 [CC]	fungal-type vacuole membrane	confident	GO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0031152 [BP]	aggregation involved in sorocarp development	confident	GO:0030582, GO:0030587, GO:0061458, GO:0019954, GO:0009991, GO:0075259, GO:0042594, GO:0007275, GO:0044699, GO:0000003, GO:0048513, GO:0032502, GO:0032501, GO:0048608, GO:0044767, GO:0022414, GO:0006950, GO:0008150, GO:0055084, GO:0044707, GO:0009605, GO:0003006, GO:0050896, GO:0048856, GO:0031667, GO:0048731
GO:0090334 [BP]	regulation of cell wall (1->3)-beta-D-glucan biosynthetic process	confident	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0032885, GO:0050789, GO:0032881, GO:2000112, GO:0065007, GO:0010962, GO:0060255, GO:0009889, GO:0050794, GO:0032951, GO:0032950, GO:0032953, GO:0032952, GO:0008150, GO:0010675, GO:0043255, GO:0032995, GO:0044087, GO:0010556, GO:0006109, GO:0010981
GO:0050771 [BP]	negative regulation of axonogenesis	confident	GO:0022604, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051129, GO:0051128, GO:0060284, GO:0031345, GO:0031344, GO:0044699, GO:0050767, GO:0048869, GO:0050768, GO:0050789, GO:0045664, GO:0010769, GO:0065007, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0010975, GO:0048731, GO:0022008, GO:0051093, GO:0048699, GO:0050770, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0008150, GO:0048523
GO:0050773 [BP]	regulation of dendrite development	confident	GO:0010975, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0050772 [BP]	positive regulation of axonogenesis	confident	GO:0022604, GO:0032502, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051128, GO:0031344, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0060284, GO:0050769, GO:0045664, GO:0010769, GO:0065007, GO:0010720, GO:0048518, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0010975, GO:0022008, GO:0048699, GO:0050770, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0050789, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0051285 [CC]	cell cortex of cell tip	confident	GO:0005737, GO:0060187, GO:0051286, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0009617 [BP]	response to bacterium	confident	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0009612 [BP]	response to mechanical stimulus	confident	GO:0009628, GO:0050896, GO:0008150, GO:0009605
GO:0018991 [BP]	oviposition	confident	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0000915 [BP]	cytokinesis, actomyosin contractile ring assembly	confident	GO:0000910, GO:0006996, GO:0000912, GO:0022607, GO:0032506, GO:0031032, GO:0030029, GO:0007049, GO:0071840, GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044085, GO:0022402, GO:0030036, GO:0044763, GO:0007010, GO:0051301
GO:0032949 [BP]	regulation of alpha-glucan biosynthetic process	confident	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0010962, GO:0008150, GO:0032948, GO:0043255, GO:0006109, GO:0032885, GO:0032881, GO:0010675
GO:0033688 [BP]	regulation of osteoblast proliferation	confident	GO:0042127, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007117 [BP]	budding cell bud growth	confident	GO:0007114, GO:0032505, GO:0019954, GO:0009987, GO:0008150, GO:0044699, GO:0044763, GO:0000003, GO:0051301, GO:0040007
GO:0043497 [BP]	regulation of protein heterodimerization activity	confident	GO:0008150, GO:0065007, GO:0065009, GO:0051098, GO:0043393
GO:0030307 [BP]	positive regulation of cell growth	confident	GO:0045927, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	confident	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0090307 [BP]	spindle assembly involved in mitosis	confident	GO:0022607, GO:0070271, GO:0043933, GO:0022402, GO:0008150, GO:0007067, GO:0051225, GO:0007049, GO:0071822, GO:0071840, GO:0000280, GO:0016043, GO:0065003, GO:0044699, GO:0009987, GO:0000278, GO:0006461, GO:0007051, GO:0007052, GO:0044763, GO:0070925, GO:0006996, GO:0007017, GO:0007010, GO:0044085, GO:0048285, GO:0000226
GO:0009749 [BP]	response to glucose stimulus	confident	GO:0009746, GO:1901700, GO:0009743, GO:0034284, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0010592 [BP]	positive regulation of lamellipodium assembly	confident	GO:0010591, GO:0051130, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:0032955 [BP]	regulation of barrier septum assembly	confident	GO:0051726, GO:1901891, GO:0010564, GO:0051128, GO:0050789, GO:0044087, GO:0065007, GO:0032954, GO:0032465, GO:0008150, GO:0050794, GO:0051302
GO:0042074 [BP]	cell migration involved in gastrulation	confident	GO:0048598, GO:0032502, GO:0016477, GO:0044707, GO:0048870, GO:0009987, GO:0032501, GO:0007369, GO:0006928, GO:0044767, GO:0009790, GO:0051674, GO:0044763, GO:0040011, GO:0051179, GO:0008150, GO:0001667, GO:0009653, GO:0007275, GO:0044699, GO:0048856
GO:0030950 [BP]	establishment or maintenance of actin cytoskeleton polarity	confident	GO:0006996, GO:0007010, GO:0030952, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0007163, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0035690 [BP]	cellular response to drug	confident	GO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0090316 [BP]	positive regulation of intracellular protein transport	confident	GO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0090003 [BP]	regulation of establishment of protein localization to plasma membrane	confident	GO:0070201, GO:0060341, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0032880
GO:0002064 [BP]	epithelial cell development	confident	GO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0048468, GO:0009888, GO:0044767, GO:0044763, GO:0030855, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0008258 [BP]	head involution	confident	GO:0048598, GO:0032502, GO:0001700, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0060237 [BP]	regulation of fungal-type cell wall organization	confident	GO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051128
GO:0016337 [BP]	cell-cell adhesion	confident	GO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0034332 [BP]	adherens junction organization	confident	GO:0034330, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0008150, GO:0044699
GO:0005813 [CC]	centrosome	confident	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0045987 [BP]	positive regulation of smooth muscle contraction	confident	GO:0045933, GO:0044057, GO:0006937, GO:0051240, GO:0006940, GO:0065007, GO:0090257, GO:0051239, GO:0048518, GO:0008150, GO:0050789
GO:0005777 [CC]	peroxisome	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043124 [BP]	negative regulation of I-kappaB kinase/NF-kappaB cascade	confident	GO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0010627, GO:0010741, GO:0043122
GO:0031902 [CC]	late endosome membrane	confident	GO:0005737, GO:0005575, GO:0005770, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0043900 [BP]	regulation of multi-organism process	confident	GO:0008150, GO:0065007, GO:0050789
GO:0048011 [BP]	neurotrophin TRK receptor signaling pathway	confident	GO:0007166, GO:0007167, GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0038179, GO:0009987, GO:0050794, GO:0008150, GO:0042221, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0044763
GO:0048015 [BP]	phosphatidylinositol-mediated signaling	confident	GO:0044700, GO:0051716, GO:0044699, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0048017
GO:0032869 [BP]	cellular response to insulin stimulus	confident	GO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0072686 [CC]	mitotic spindle	confident	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030335 [BP]	positive regulation of cell migration	confident	GO:0051272, GO:0030334, GO:0040017, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0034613 [BP]	cellular protein localization	confident	GO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0005802 [CC]	trans-Golgi network	confident	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030426 [CC]	growth cone	confident	GO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0061383 [BP]	trabecula morphogenesis	confident	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0043280 [BP]	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	confident	GO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0035023 [BP]	regulation of Rho protein signal transduction	confident	GO:0051056, GO:0009966, GO:0048583, GO:0046578, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0055037 [CC]	recycling endosome	confident	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0045453 [BP]	bone resorption	confident	GO:0032501, GO:0044707, GO:0048871, GO:0060249, GO:0048771, GO:0042592, GO:0008150, GO:0046849, GO:0065007, GO:0001894, GO:0065008, GO:0044699
GO:2000769 [BP]	regulation of establishment or maintenance of cell polarity regulating cell shape	confident	GO:0008150, GO:0032878, GO:0065007, GO:0050789, GO:0050794
GO:0007394 [BP]	dorsal closure, elongation of leading edge cells	confident	GO:0022604, GO:0032502, GO:0016331, GO:0051239, GO:0048589, GO:0022603, GO:0051128, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0009826, GO:0001700, GO:0016049, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0065007, GO:0071840, GO:0048729, GO:0016476, GO:0060560, GO:0048598, GO:0060429, GO:0002009, GO:0050793, GO:0032501, GO:0009987, GO:0009888, GO:0050794, GO:0044767, GO:0008360, GO:0044763, GO:0045995, GO:0040007, GO:0065008, GO:0044707, GO:0048856, GO:0007392, GO:0007391, GO:0050789, GO:2000026, GO:0008150
GO:0007390 [BP]	germ-band shortening	confident	GO:0048598, GO:0032502, GO:0001700, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0001932 [BP]	regulation of protein phosphorylation	confident	GO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789
GO:0051650 [BP]	establishment of vesicle localization	probable	GO:0051656, GO:0009987, GO:0044763, GO:0044699, GO:0051648, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0051640, GO:0051641
GO:0034191 [MF]	apolipoprotein A-I receptor binding	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0034190
GO:0031103 [BP]	axon regeneration	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0048678, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0051716, GO:0000904, GO:0000902, GO:0048869, GO:0031099, GO:0009611, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0031102, GO:0030182, GO:0009987, GO:0044767, GO:0006950, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0050896, GO:0048856, GO:0048812, GO:0033554, GO:0008150
GO:0097178 [BP]	ruffle assembly	probable	GO:0031529, GO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0010593 [BP]	negative regulation of lamellipodium assembly	probable	GO:0010591, GO:0008150, GO:0009987, GO:0051129, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0050794, GO:0031345, GO:0031344, GO:0048523
GO:0071338 [BP]	positive regulation of hair follicle cell proliferation	probable	GO:0008284, GO:0042127, GO:0050794, GO:0071336, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0051668 [BP]	localization within membrane	probable	GO:0009987, GO:0008150, GO:0044763, GO:0051179, GO:0044699, GO:0051641
GO:0048554 [BP]	positive regulation of metalloenzyme activity	probable	GO:0048552, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0060071 [BP]	Wnt receptor signaling pathway, planar cell polarity pathway	probable	GO:0022603, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0065007, GO:0050793, GO:0009987, GO:0050794, GO:0044763, GO:0051239, GO:0007154, GO:0035567, GO:0044700, GO:0090175, GO:0050896, GO:0016055, GO:2000026, GO:2000027, GO:0008150
GO:0051683 [BP]	establishment of Golgi localization	probable	GO:0044699, GO:0051234, GO:0009987, GO:0044763, GO:0051640, GO:0051649, GO:0008150, GO:0051656, GO:0051179, GO:0051645, GO:0051641
GO:0014065 [BP]	phosphatidylinositol 3-kinase cascade	probable	GO:0044700, GO:0051716, GO:0044699, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0048015, GO:0050789, GO:0048017
GO:0090136 [BP]	epithelial cell-cell adhesion	probable	GO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0090135 [BP]	actin filament branching	probable	GO:0006996, GO:0007015, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0031532 [BP]	actin cytoskeleton reorganization	probable	GO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0040026 [BP]	positive regulation of vulval development	probable	GO:0051094, GO:0050793, GO:0040028, GO:0048580, GO:0008150, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0061062, GO:0050789
GO:0040027 [BP]	negative regulation of vulval development	probable	GO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0071216 [BP]	cellular response to biotic stimulus	probable	GO:0051716, GO:0009607, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0060047 [BP]	heart contraction	probable	GO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0003015, GO:0044699, GO:0003008
GO:0031384 [BP]	regulation of initiation of mating projection growth	probable	GO:0022604, GO:0022603, GO:0050793, GO:0031137, GO:2000241, GO:0048583, GO:0043900, GO:0050789, GO:0044087, GO:0060491, GO:0046999, GO:0065007, GO:0050794, GO:0008150, GO:0051128, GO:0031344, GO:0031383
GO:0048615 [BP]	embryonic anterior midgut (ectodermal) morphogenesis	probable	GO:0048613, GO:0032502, GO:0016331, GO:0048562, GO:0048565, GO:0048567, GO:0048566, GO:0048568, GO:0048611, GO:0055123, GO:0009790, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007439, GO:0048513, GO:0048729, GO:0048598, GO:0009887, GO:0048557, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0007441, GO:0044707, GO:0048856, GO:0048731, GO:0048546
GO:0006913 [BP]	nucleocytoplasmic transport	probable	GO:0051169, GO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0007516 [BP]	hemocyte development	probable	GO:0032502, GO:0042386, GO:0048856, GO:0002376, GO:0030154, GO:0048468, GO:0044767, GO:0044763, GO:0048869, GO:0008150, GO:0009987, GO:0044699
GO:0021831 [BP]	embryonic olfactory bulb interneuron precursor migration	probable	GO:0021537, GO:0032502, GO:0044707, GO:0021826, GO:0030154, GO:0048468, GO:0006928, GO:0021988, GO:0051674, GO:0021885, GO:0021889, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0021891, GO:0048513, GO:0021879, GO:0030900, GO:0016477, GO:0021872, GO:0021953, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0048731, GO:0044767, GO:0008150, GO:0021772, GO:0051179, GO:0022008, GO:0022028, GO:0022029, GO:0040011, GO:0048699, GO:0007420, GO:0007399, GO:0048870, GO:0048856, GO:0021843, GO:0044763
GO:0032427 [MF]	GBD domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0046843 [BP]	dorsal appendage formation	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0007292, GO:0007304, GO:0007306, GO:0009653, GO:0044699, GO:0007276, GO:0000003, GO:0030703, GO:0030707, GO:0016043, GO:0032989, GO:0071840, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0044763
GO:0007349 [BP]	cellularization	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0009653, GO:0007275, GO:0048646
GO:0043552 [BP]	positive regulation of phosphatidylinositol 3-kinase activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0043549, GO:0065007, GO:0044093, GO:0048518, GO:0045834, GO:0065009, GO:0042325, GO:0090218, GO:0019216, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0043551, GO:0043550, GO:0051338
GO:0035149 [BP]	lumen formation, open tracheal system	probable	GO:0032502, GO:0007424, GO:0035152, GO:0009653, GO:0035239, GO:0044707, GO:0008150, GO:0060541, GO:0048856, GO:0035148, GO:0044767, GO:0032501, GO:0065007, GO:0044699, GO:0048731, GO:0035295, GO:0065008, GO:0007275, GO:0048646
GO:0045860 [BP]	positive regulation of protein kinase activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0008286 [BP]	insulin receptor signaling pathway	probable	GO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0048846 [BP]	axon extension involved in axon guidance	probable	GO:0048675, GO:0048666, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0032502, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0040011, GO:0048699, GO:0048858, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0008150
GO:0048532 [BP]	anatomical structure arrangement	probable	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0048664 [BP]	neuron fate determination	probable	GO:0032502, GO:0048699, GO:0045165, GO:0048663, GO:0030182, GO:0009987, GO:0048869, GO:0001709, GO:0007399, GO:0044707, GO:0032501, GO:0044763, GO:0048731, GO:0030154, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0048066 [BP]	developmental pigmentation	probable	GO:0032502, GO:0043473, GO:0008150, GO:0044699
GO:0048261 [BP]	negative regulation of receptor-mediated endocytosis	probable	GO:0032879, GO:0051051, GO:0050794, GO:0051049, GO:0008150, GO:0009987, GO:0051129, GO:0060627, GO:0051128, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0048259, GO:0045806, GO:0030100, GO:0050789, GO:0048523
GO:0010171 [BP]	body morphogenesis	probable	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0007520 [BP]	myoblast fusion	probable	GO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0044351 [BP]	macropinocytosis	probable	GO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0071907 [BP]	determination of digestive tract left/right asymmetry	probable	GO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0007389, GO:0007368, GO:0048856, GO:0044767, GO:0008150, GO:0009855, GO:0009799, GO:0048731, GO:0007275, GO:0044699
GO:0003334 [BP]	keratinocyte development	probable	GO:0030154, GO:0048468, GO:0008544, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0030855, GO:0002064, GO:0032502, GO:0032501, GO:0030216, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048731, GO:0044707, GO:0009913, GO:0048856, GO:0044763, GO:0009987
GO:0042176 [BP]	regulation of protein catabolic process	probable	GO:0009894, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:0051450 [BP]	myoblast proliferation	probable	GO:0008150, GO:0044699, GO:0008283
GO:0002551 [BP]	mast cell chemotaxis	probable	GO:0040011, GO:0030595, GO:0006935, GO:0042330, GO:0048870, GO:0050896, GO:0009987, GO:0044763, GO:0051716, GO:0006928, GO:0002376, GO:0050900, GO:0051674, GO:0008150, GO:0070887, GO:0060326, GO:0042221, GO:0051179, GO:0016477, GO:0009605, GO:0044699
GO:0021799 [BP]	cerebral cortex radially oriented cell migration	probable	GO:0021537, GO:0044707, GO:0006928, GO:0051674, GO:0021885, GO:0021987, GO:0044699, GO:0007417, GO:0051179, GO:0048513, GO:0016477, GO:0021795, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0021543, GO:0008150, GO:0022029, GO:0040011, GO:0007420, GO:0007399, GO:0048870, GO:0048856, GO:0044763, GO:0030900, GO:0007275, GO:0048731
GO:0005912 [CC]	adherens junction	probable	GO:0005575, GO:0070161, GO:0030054
GO:0030742 [MF]	GTP-dependent protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0031295 [BP]	T cell costimulation	probable	GO:0051249, GO:0051251, GO:0050867, GO:0065007, GO:0050865, GO:0050863, GO:0050794, GO:0002376, GO:0002694, GO:0002684, GO:0002696, GO:0008150, GO:0050870, GO:0048518, GO:0002682, GO:0048522, GO:0050789, GO:0031294
GO:0010629 [BP]	negative regulation of gene expression	probable	GO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0001764 [BP]	neuron migration	probable	GO:0040011, GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0036187 [BP]	cell growth mode switching, budding to filamentous	probable	GO:0070784, GO:1900428, GO:0040008, GO:0010570, GO:0065007, GO:0008150, GO:0050789
GO:0001780 [BP]	neutrophil homeostasis	probable	GO:0042592, GO:0048872, GO:0002262, GO:0002376, GO:0001776, GO:0008150, GO:0065007, GO:0065008
GO:0010590 [BP]	regulation of cytokinetic cell separation	probable	GO:0051726, GO:0010564, GO:0050794, GO:0050789, GO:0065007, GO:0032954, GO:0032465, GO:0008150, GO:0051302
GO:0071393 [BP]	cellular response to progesterone stimulus	probable	GO:0071383, GO:0070887, GO:0014070, GO:0009719, GO:0051716, GO:0033993, GO:0071310, GO:0044699, GO:0071495, GO:0009987, GO:0032570, GO:0071396, GO:0032870, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0050896, GO:1901654, GO:1901655, GO:0009725, GO:0008150, GO:0048545
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0033138 [BP]	positive regulation of peptidyl-serine phosphorylation	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033135, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0042346 [BP]	positive regulation of NF-kappaB import into nucleus	probable	GO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0048583, GO:0023051, GO:0051222, GO:0051223, GO:0010627, GO:0050789, GO:0032880, GO:0010646, GO:0009966, GO:0065007, GO:0048518, GO:0043122, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:0042993, GO:0042990, GO:1900180, GO:0042345, GO:0046824, GO:0046822
GO:0006471 [BP]	protein ADP-ribosylation	probable	GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0005522 [MF]	profilin binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0009788 [BP]	negative regulation of abscisic acid mediated signaling pathway	probable	GO:0009968, GO:0023057, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0050789, GO:1901420, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:1901419, GO:0048523, GO:0009787
GO:0070610 [BP]	regulation of fungal-type cell wall (1->3)-alpha-glucan biosynthetic process	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0032885, GO:0032949, GO:0032948, GO:0032881, GO:0070607, GO:0070606, GO:0070605, GO:2000112, GO:0070609, GO:0070608, GO:0065007, GO:0010962, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0010675, GO:0043255, GO:0050789, GO:0044087, GO:0010556, GO:0006109, GO:0010981
GO:0071963 [BP]	establishment or maintenance of cell polarity regulating cell shape	probable	GO:0022604, GO:0008360, GO:0022603, GO:0050793, GO:0009987, GO:0051128, GO:0008150, GO:0007163, GO:0044763, GO:0050794, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0035264 [BP]	multicellular organism growth	probable	GO:0044699, GO:0032501, GO:0008150, GO:0040007, GO:0044707
GO:0043326 [BP]	chemotaxis to folate	probable	GO:1901700, GO:0043200, GO:0009991, GO:0006935, GO:0042330, GO:0008150, GO:0050896, GO:0007584, GO:1901698, GO:0031667, GO:0009719, GO:0009605, GO:0051593, GO:0040011, GO:0033273, GO:0001101, GO:0042221, GO:0010033, GO:0014070, GO:0010243
GO:0003161 [BP]	cardiac conduction system development	probable	GO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0072358, GO:0048856, GO:0044767, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035318 [BP]	imaginal disc-derived wing hair outgrowth	probable	GO:0048563, GO:0030030, GO:0060429, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0008544, GO:0000902, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0032989, GO:0048569, GO:0048513, GO:0071840, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0009987, GO:0009888, GO:0035114, GO:0044763, GO:0048731, GO:0022008, GO:0048858, GO:0035317, GO:0044767, GO:0048699, GO:0032990, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0007399, GO:0008150, GO:0048736, GO:0048737
GO:0042742 [BP]	defense response to bacterium	probable	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0000132 [BP]	establishment of mitotic spindle orientation	probable	GO:0008104, GO:0051653, GO:0007163, GO:0000226, GO:0030010, GO:0051656, GO:0044699, GO:0040001, GO:0071840, GO:0016043, GO:0008150, GO:0007049, GO:0033036, GO:0006996, GO:0000278, GO:0051294, GO:0009987, GO:0051293, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0031503, GO:0007017, GO:0007010, GO:0022402
GO:0001403 [BP]	invasive growth in response to glucose limitation	probable	GO:0036267, GO:0040007, GO:0030447, GO:0044182, GO:0008150, GO:0044699, GO:0070783
GO:0032467 [BP]	positive regulation of cytokinesis	probable	GO:0090068, GO:0051726, GO:0010564, GO:0050794, GO:0050789, GO:0048518, GO:0051781, GO:0065007, GO:0032465, GO:0008150, GO:0051302, GO:0048522
GO:0030225 [BP]	macrophage differentiation	probable	GO:0032502, GO:0002376, GO:0048856, GO:0044707, GO:0008150, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0048731, GO:0002573, GO:0044767, GO:0048513, GO:0044763, GO:0044699, GO:0030099, GO:0030097, GO:0048534, GO:0007275, GO:0002521, GO:0002520
GO:0046331 [BP]	lateral inhibition	probable	GO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0060789 [BP]	hair follicle placode formation	probable	GO:0022404, GO:0022405, GO:0009653, GO:0007275, GO:0044699, GO:0008544, GO:0071697, GO:0001942, GO:0048513, GO:0048646, GO:0060788, GO:0032502, GO:0032501, GO:0009888, GO:0044767, GO:0008150, GO:0042633, GO:0042303, GO:0071696, GO:0044707, GO:0048856, GO:0048731
GO:0048315 [BP]	conidium formation	probable	GO:0032502, GO:0000003, GO:0019954, GO:0048856, GO:0043934, GO:0044767, GO:0030436, GO:0008150, GO:0044699, GO:0009653, GO:0048646
GO:0060070 [BP]	canonical Wnt receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0072384 [BP]	organelle transport along microtubule	probable	GO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0006928, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0030705, GO:0051179, GO:0044699, GO:0051641
GO:0009416 [BP]	response to light stimulus	probable	GO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0045200 [BP]	establishment of neuroblast polarity	probable	GO:0055059, GO:0030154, GO:0055057, GO:0045196, GO:0048103, GO:0007163, GO:0030010, GO:0007405, GO:0051301, GO:0048869, GO:0007275, GO:0044699, GO:0061351, GO:0032502, GO:0032501, GO:0008283, GO:0009987, GO:0044763, GO:0048731, GO:0022008, GO:0017145, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0072089
GO:0031424 [BP]	keratinization	probable	GO:0032502, GO:0032501, GO:0044707, GO:0030216, GO:0009913, GO:0048869, GO:0060429, GO:0044763, GO:0009888, GO:0048513, GO:0008150, GO:0030855, GO:0030154, GO:0048731, GO:0009987, GO:0008544, GO:0007275, GO:0044699, GO:0048856
GO:0019048 [BP]	virus-host interaction	probable	GO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0007274 [BP]	neuromuscular synaptic transmission	probable	GO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0071542 [BP]	dopaminergic neuron differentiation	probable	GO:0032502, GO:0048699, GO:0009987, GO:0030182, GO:0007399, GO:0044707, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0046326 [BP]	positive regulation of glucose import	probable	GO:0051050, GO:0051049, GO:0050789, GO:0010827, GO:0065007, GO:0046324, GO:0048518, GO:0008150, GO:0032879, GO:0010828
GO:0051963 [BP]	regulation of synapse assembly	probable	GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0023052, GO:0050789, GO:0044699, GO:0065007, GO:0065008, GO:0032501, GO:0050793, GO:0050877, GO:0009987, GO:0050794, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0044087, GO:0051960, GO:2000026, GO:0044763
GO:0050764 [BP]	regulation of phagocytosis	probable	GO:0032879, GO:0051049, GO:0051128, GO:0060627, GO:0065007, GO:0008150, GO:0050794, GO:0030100, GO:0050789
GO:0060684 [BP]	epithelial-mesenchymal cell signaling	probable	GO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0007267, GO:0044763, GO:0044699
GO:0031234 [CC]	extrinsic to internal side of plasma membrane	probable	GO:0019897, GO:0016020, GO:0044464, GO:0009898, GO:0005622, GO:0005575, GO:0071944, GO:0005623, GO:0005886, GO:0044424, GO:0044425, GO:0019898, GO:0044459
GO:0090037 [BP]	positive regulation of protein kinase C signaling cascade	probable	GO:0090036, GO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0048522
GO:0051149 [BP]	positive regulation of muscle cell differentiation	probable	GO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0051147, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0009531 [CC]	secondary cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009505
GO:0031435 [MF]	mitogen-activated protein kinase kinase kinase binding	probable	GO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0000905 [BP]	sporocarp development involved in asexual reproduction	probable	GO:0032502, GO:0030582, GO:0032501, GO:0030584, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0019954, GO:0048856, GO:0075259, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0048608, GO:0007275, GO:0044699
GO:0050885 [BP]	neuromuscular process controlling balance	probable	GO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0031333 [BP]	negative regulation of protein complex assembly	probable	GO:0009987, GO:0051129, GO:0051128, GO:0008150, GO:0044087, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0043254, GO:0050794, GO:0050789, GO:0048523
GO:0035320 [BP]	imaginal disc-derived wing hair site selection	probable	GO:0022606, GO:0030030, GO:0030154, GO:0035107, GO:0048563, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0007163, GO:0007164, GO:0030010, GO:0009653, GO:0035316, GO:0007275, GO:0061162, GO:0035315, GO:0002009, GO:0008544, GO:0007472, GO:0048869, GO:0071840, GO:0007552, GO:0007476, GO:0016043, GO:0035317, GO:0048569, GO:0048513, GO:0044699, GO:0048729, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0061339, GO:0032501, GO:0060429, GO:0009888, GO:0035114, GO:0001738, GO:0008150, GO:0048731, GO:0009887, GO:0022008, GO:0001737, GO:0001736, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0044763, GO:0009987, GO:0048736, GO:0048737
GO:0007119 [BP]	budding cell isotropic bud growth	probable	GO:0007114, GO:0007117, GO:0032505, GO:0019954, GO:0009987, GO:0008150, GO:0044699, GO:0044763, GO:0000003, GO:0051301, GO:0040007
GO:0007118 [BP]	budding cell apical bud growth	probable	GO:0007114, GO:0007117, GO:0032505, GO:0019954, GO:0009987, GO:0008150, GO:0044699, GO:0044763, GO:0000003, GO:0051301, GO:0040007
GO:0016318 [BP]	ommatidial rotation	probable	GO:0048749, GO:0060429, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001745, GO:0008150, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0002009, GO:0042067, GO:0048592, GO:0009987, GO:0009888, GO:0044767, GO:0001738, GO:0001654, GO:0048731, GO:0001736, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0017137 [MF]	Rab GTPase binding	probable	GO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0051835 [BP]	positive regulation of synapse structural plasticity	probable	GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0023052, GO:0050789, GO:0044699, GO:0065007, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050877, GO:0009987, GO:0050794, GO:0008150, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0044763, GO:0051823, GO:0048522
GO:0048747 [BP]	muscle fiber development	probable	GO:0032502, GO:0055001, GO:0055002, GO:0048856, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0044763, GO:0051146, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0042470 [CC]	melanosome	probable	GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0048770, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0044464, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051988 [BP]	regulation of attachment of spindle microtubules to kinetochore	probable	GO:0032879, GO:0060341, GO:0033043, GO:0051493, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0032886, GO:0070507, GO:0050789, GO:0051983, GO:0032880
GO:0007286 [BP]	spermatid development	probable	GO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:2000391 [BP]	positive regulation of neutrophil extravasation	probable	GO:0050789, GO:0002682, GO:0002687, GO:0002684, GO:0002685, GO:0065007, GO:0048518, GO:2000145, GO:0030335, GO:0030334, GO:0002693, GO:0050794, GO:0051270, GO:0008150, GO:0032879, GO:0051272, GO:0040012, GO:0040017, GO:2000389, GO:0002691, GO:2000147, GO:0048522
GO:0006886 [BP]	intracellular protein transport	probable	GO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0007124 [BP]	pseudohyphal growth	probable	GO:0016049, GO:0070783, GO:0030447, GO:0009987, GO:0044182, GO:0044763, GO:0008150, GO:0044699, GO:0040007
GO:0050975 [BP]	sensory perception of touch	probable	GO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0061299 [BP]	retina vasculature morphogenesis in camera-type eye	probable	GO:0032502, GO:0048513, GO:0044699, GO:0032501, GO:0007423, GO:0044707, GO:0001654, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0060041, GO:0048731, GO:0009653, GO:0043010, GO:0007275, GO:0061298
GO:0046688 [BP]	response to copper ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:1900445 [BP]	positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus	probable	GO:1900430, GO:0090033, GO:0048583, GO:1900428, GO:0048584, GO:0002831, GO:0002833, GO:0010570, GO:0050789, GO:1900443, GO:0065007, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0008103 [BP]	oocyte microtubule cytoskeleton polarization	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0007163, GO:0000226, GO:0007309, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0030952, GO:0030951, GO:0048869, GO:0071840, GO:0016043, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0016325, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044702, GO:0044763, GO:0022412, GO:0000003, GO:0006996, GO:0044767, GO:0007017, GO:0007010, GO:0044707, GO:0003006, GO:0048856, GO:0008150
GO:0090005 [BP]	negative regulation of establishment of protein localization to plasma membrane	probable	GO:0070201, GO:0032879, GO:0060341, GO:0009987, GO:0051129, GO:0051128, GO:0008150, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0050794, GO:0090003, GO:0050789, GO:0048523, GO:0032880
GO:0090004 [BP]	positive regulation of establishment of protein localization to plasma membrane	probable	GO:0051130, GO:0070201, GO:0032879, GO:0060341, GO:0051128, GO:0032880, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0090003, GO:0050789, GO:0048522
GO:0010310 [BP]	regulation of hydrogen peroxide metabolic process	probable	GO:0019222, GO:0031323, GO:2000377, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0008078 [BP]	mesodermal cell migration	probable	GO:0032502, GO:0007498, GO:0042074, GO:0006928, GO:0009790, GO:0051674, GO:0001667, GO:0009653, GO:0007275, GO:0044699, GO:0001707, GO:0001704, GO:0007369, GO:0048729, GO:0016477, GO:0048646, GO:0048598, GO:0032501, GO:0048332, GO:0009987, GO:0009888, GO:0044767, GO:0008150, GO:0051179, GO:0090130, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0007509, GO:0044763
GO:0007419 [BP]	ventral cord development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0007413 [BP]	axonal fasciculation	probable	GO:0008037, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0008038, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0044707, GO:0048856, GO:0007399, GO:0032502, GO:0048812, GO:0008150
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0033563 [BP]	dorsal/ventral axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0072697 [BP]	protein localization to cell cortex	probable	GO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0045610 [BP]	regulation of hemocyte differentiation	probable	GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0002682, GO:0051239, GO:0065007, GO:0050789
GO:0016335 [BP]	morphogenesis of larval imaginal disc epithelium	probable	GO:0048563, GO:0048569, GO:0009887, GO:0009791, GO:0002165, GO:0002164, GO:0009653, GO:0007275, GO:0044699, GO:0002168, GO:0002009, GO:0007552, GO:0048513, GO:0048729, GO:0032502, GO:0048707, GO:0009886, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731
GO:0034334 [BP]	adherens junction maintenance	probable	GO:0009987, GO:0034332, GO:0034331, GO:0034330, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0043954, GO:0008150, GO:0044699
GO:0050690 [BP]	regulation of defense response to virus by virus	probable	GO:0050688, GO:0048583, GO:0080134, GO:0002831, GO:0043900, GO:0008150, GO:0002697, GO:0002682, GO:0065007, GO:0050789, GO:0031347
GO:0030437 [BP]	ascospore formation	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0043935, GO:0043934, GO:0022402, GO:0009653, GO:0044699, GO:0000003, GO:0003006, GO:0048869, GO:0034293, GO:0007049, GO:0048646, GO:0032502, GO:0032505, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022413, GO:0030435, GO:0048856, GO:0008150
GO:0002093 [BP]	auditory receptor cell morphogenesis	probable	GO:0048666, GO:0048562, GO:0048568, GO:0030154, GO:0048468, GO:0009790, GO:0060119, GO:0008544, GO:0060113, GO:0009653, GO:0007275, GO:0044699, GO:0035315, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0016043, GO:0060117, GO:0048513, GO:0043583, GO:0030855, GO:0002064, GO:0048598, GO:0048667, GO:0009887, GO:0032501, GO:0030182, GO:0060429, GO:0048699, GO:0009888, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0042471, GO:0048839, GO:0042472, GO:0007423, GO:0044707, GO:0009913, GO:0048856, GO:0007399, GO:0042491, GO:0042490, GO:0032502, GO:0032989, GO:0044763, GO:0009987
GO:0005778 [CC]	peroxisomal membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0045185 [BP]	maintenance of protein location	probable	GO:0008104, GO:0065008, GO:0008150, GO:0065007, GO:0051235, GO:0033036, GO:0051179
GO:0060661 [BP]	submandibular salivary gland formation	probable	GO:0032502, GO:0048513, GO:0007435, GO:0044707, GO:0007431, GO:0032501, GO:0048856, GO:0044767, GO:0035272, GO:0008150, GO:0048646, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699
GO:0090103 [BP]	cochlea morphogenesis	probable	GO:0032502, GO:0048562, GO:0048568, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0090102, GO:0048513, GO:0043583, GO:0048598, GO:0009887, GO:0032501, GO:0044767, GO:0008150, GO:0042471, GO:0048839, GO:0042472, GO:0044707, GO:0007423, GO:0048856, GO:0048731
GO:0006954 [BP]	inflammatory response	probable	GO:0006952, GO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0007426 [BP]	tracheal outgrowth, open tracheal system	probable	GO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0003382 [BP]	epithelial cell morphogenesis	probable	GO:0032502, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0060429, GO:0048468, GO:0009888, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0030855, GO:0030154, GO:0008150, GO:0009987, GO:0009653, GO:0002064, GO:0048856
GO:0032863 [BP]	activation of Rac GTPase activity	probable	GO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0023051, GO:0046578, GO:0032862, GO:0035023, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0032855, GO:0032856, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0032321, GO:0031329, GO:0006140
GO:0042052 [BP]	rhabdomere development	probable	GO:0048666, GO:0044707, GO:0042051, GO:0030154, GO:0048468, GO:0001745, GO:0007275, GO:0071840, GO:0042462, GO:0042461, GO:0009653, GO:0048869, GO:0016043, GO:0048513, GO:0044699, GO:0048749, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0006996, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150, GO:0032502
GO:0042059 [BP]	negative regulation of epidermal growth factor receptor signaling pathway	probable	GO:0010646, GO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0042058, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:1901184, GO:1901185, GO:0050789, GO:0048523
GO:0035212 [BP]	cell competition in a multicellular organism	probable	GO:0032502, GO:0032501, GO:0044707, GO:0040008, GO:0009987, GO:0050789, GO:0065007, GO:0044763, GO:0008150, GO:0007275, GO:0044699
GO:0030994 [BP]	primary cell septum disassembly	probable	GO:0000910, GO:0007049, GO:0032506, GO:0022402, GO:0009987, GO:0000920, GO:0016043, GO:0008150, GO:0044763, GO:0051301, GO:0071840, GO:0022411, GO:0044699
GO:0007096 [BP]	regulation of exit from mitosis	probable	GO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0007088, GO:0050789
GO:0007097 [BP]	nuclear migration	probable	GO:0051234, GO:0040023, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641
GO:0030041 [BP]	actin filament polymerization	probable	GO:0022607, GO:0070271, GO:0043933, GO:0030036, GO:0034622, GO:0071840, GO:0071822, GO:0016043, GO:0065003, GO:0044699, GO:0009987, GO:0030029, GO:0007015, GO:0006461, GO:0008154, GO:0044763, GO:0043623, GO:0006996, GO:0051258, GO:0007010, GO:0044085, GO:0008150
GO:0031069 [BP]	hair follicle morphogenesis	probable	GO:0032502, GO:0048513, GO:0009887, GO:0008544, GO:0044707, GO:0032501, GO:0001942, GO:0048856, GO:0009888, GO:0044767, GO:0042633, GO:0022404, GO:0022405, GO:0008150, GO:0048729, GO:0048730, GO:0048731, GO:0009653, GO:0042303, GO:0007275, GO:0044699
GO:0035025 [BP]	positive regulation of Rho protein signal transduction	probable	GO:0051057, GO:0051056, GO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0046578, GO:0046579, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0035023, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0002040 [BP]	sprouting angiogenesis	probable	GO:0032502, GO:0032501, GO:0009653, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0044699, GO:0048731, GO:0008150, GO:0001525, GO:0007275, GO:0048646
GO:0031647 [BP]	regulation of protein stability	probable	GO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0045451 [BP]	pole plasm oskar mRNA localization	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0022607, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0008298, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0044702, GO:0048856, GO:0044085, GO:0048869, GO:0044763, GO:0009987
GO:0036180 [BP]	filamentous growth of a population of unicellular organisms in response to biotic stimulus	probable	GO:0009607, GO:0040007, GO:0050896, GO:0044182, GO:0008150, GO:0030447, GO:0044699
GO:0040002 [BP]	collagen and cuticulin-based cuticle development	probable	GO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0002446 [BP]	neutrophil mediated immunity	probable	GO:0002376, GO:0008150, GO:0002443, GO:0002444, GO:0002252
GO:0007396 [BP]	suture of dorsal opening	probable	GO:0048598, GO:0032502, GO:0001700, GO:0060429, GO:0044707, GO:0002009, GO:0032501, GO:0048856, GO:0016331, GO:0007391, GO:0009888, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048729, GO:0009653, GO:0007275, GO:0044699
GO:0009860 [BP]	pollen tube growth	probable	GO:0048610, GO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0009653, GO:0044699, GO:0009826, GO:0000904, GO:0016049, GO:0000003, GO:0048868, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0051704, GO:0060560, GO:0000902, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0040007, GO:0048856, GO:0044703, GO:0003006, GO:0044706, GO:0009932, GO:0009856, GO:0044763
GO:0000750 [BP]	pheromone-dependent signal transduction involved in conjugation with cellular fusion	probable	GO:0048610, GO:0070887, GO:0019953, GO:0023052, GO:0007165, GO:0007166, GO:0042221, GO:0050789, GO:0044699, GO:0000747, GO:0000746, GO:0000003, GO:0000749, GO:0071310, GO:0065007, GO:0007186, GO:0019236, GO:0009987, GO:0051716, GO:0050794, GO:0044764, GO:0044763, GO:0007154, GO:0010033, GO:0051704, GO:0044700, GO:0050896, GO:0071444, GO:0008150, GO:0032005
GO:0009734 [BP]	auxin mediated signaling pathway	probable	GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0009755, GO:0051716, GO:0009719, GO:0071310, GO:0065007, GO:0071495, GO:0009733, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0071365, GO:0009725, GO:0050896, GO:0008150
GO:0009738 [BP]	abscisic acid mediated signaling pathway	probable	GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0044699, GO:0009755, GO:0051716, GO:0009737, GO:0033993, GO:0071310, GO:0065007, GO:0071215, GO:0071495, GO:0009719, GO:1901701, GO:0009987, GO:0071396, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0010033, GO:1901700, GO:0044700, GO:0009725, GO:0050896, GO:0008150, GO:0097305, GO:0097306
GO:0007162 [BP]	negative regulation of cell adhesion	probable	GO:0030155, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0045492 [BP]	xylan biosynthetic process	probable	GO:0044036, GO:0034645, GO:0070592, GO:0016051, GO:0071840, GO:0044038, GO:1901576, GO:0044264, GO:0044262, GO:0044260, GO:0033692, GO:0071554, GO:0071704, GO:0044699, GO:0009987, GO:0000271, GO:0034637, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0010383, GO:0044723, GO:0044238, GO:0042546, GO:0005975, GO:0005976, GO:0010410, GO:0070589, GO:0044237, GO:0043170, GO:0044085, GO:0008150, GO:0045491, GO:0044249
GO:0010119 [BP]	regulation of stomatal movement	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031520 [CC]	plasma membrane of cell tip	probable	GO:0060187, GO:0051286, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0009832 [BP]	plant-type cell wall biogenesis	probable	GO:0042546, GO:0009987, GO:0071554, GO:0044085, GO:0044763, GO:0044699, GO:0008150, GO:0071840, GO:0071669
GO:0010413 [BP]	glucuronoxylan metabolic process	probable	GO:0071704, GO:0044238, GO:0005975, GO:0044260, GO:0005976, GO:0009987, GO:0044237, GO:0043170, GO:0071554, GO:0044036, GO:0044763, GO:0044699, GO:0008152, GO:0010383, GO:0008150, GO:0045491, GO:0010410, GO:0071840
GO:0045921 [BP]	positive regulation of exocytosis	probable	GO:0032879, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0060627, GO:0065007, GO:0048522, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0017157
GO:0000082 [BP]	G1/S transition of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0031991 [BP]	regulation of actomyosin contractile ring contraction	probable	GO:0000910, GO:0007049, GO:0032506, GO:0051726, GO:0044699, GO:0008150, GO:0009987, GO:0010564, GO:0050794, GO:0050789, GO:0065007, GO:0022402, GO:0032954, GO:0032465, GO:0044763, GO:0051302, GO:0051301
GO:0030834 [BP]	regulation of actin filament depolymerization	probable	GO:0030832, GO:0032970, GO:0065008, GO:0033043, GO:0071840, GO:1901879, GO:0051493, GO:0090066, GO:0016043, GO:0051128, GO:0008064, GO:0065007, GO:0044763, GO:0044699, GO:0008150, GO:0032956, GO:0043244, GO:0009987, GO:0050794, GO:0050789, GO:0032535
GO:0046325 [BP]	negative regulation of glucose import	probable	GO:0051051, GO:0051049, GO:0008150, GO:0010827, GO:0065007, GO:0046324, GO:0048519, GO:0032879, GO:0010829, GO:0050789
GO:0009086 [BP]	methionine biosynthetic process	probable	GO:0019752, GO:0044249, GO:0006807, GO:0009067, GO:0009066, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0009987, GO:0044238, GO:0000097, GO:0000096, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0008652, GO:1901564, GO:0006082, GO:1901566, GO:0044272, GO:0046394, GO:0006555, GO:0016053, GO:0044237, GO:0006790, GO:0044281
GO:0019903 [MF]	protein phosphatase binding	probable	GO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0071521 [CC]	Cdc42 GTPase complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032794 [MF]	GTPase activating protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0032488 [BP]	Cdc42 protein signal transduction	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007266, GO:0007265, GO:0007264, GO:0035556, GO:0044699
GO:0016322 [BP]	neuron remodeling	probable	GO:0032502, GO:0030154, GO:0048468, GO:0007569, GO:0010259, GO:0007275, GO:0044699, GO:0042551, GO:0048869, GO:0008150, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0005769 [CC]	early endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0000394 [BP]	RNA splicing, via endonucleolytic cleavage and ligation	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0008380, GO:0006396, GO:0046483
GO:0009664 [BP]	plant-type cell wall organization	probable	GO:0008150, GO:0009987, GO:0016043, GO:0071554, GO:0071555, GO:0044763, GO:0044699, GO:0045229, GO:0071840, GO:0071669
GO:0043458 [BP]	ethanol biosynthetic process involved in glucose fermentation to ethanol	probable	GO:0019320, GO:0046365, GO:0019655, GO:0044281, GO:0044283, GO:0006091, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006115, GO:0006113, GO:0019660, GO:0046165, GO:0009987, GO:0019318, GO:1901575, GO:0009058, GO:0008150, GO:0008152, GO:0044723, GO:0034308, GO:0034309, GO:0009056, GO:0055114, GO:0044724, GO:0044238, GO:0005975, GO:0015980, GO:0005996, GO:0016052, GO:0044237, GO:0006066, GO:0006067, GO:0006006, GO:0006007, GO:1901617, GO:1901615

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FV8, chain A
Confidence level:very confident
Coverage over the Query: 1-182
View the alignment between query and template
View the model in PyMOL