Diaphorina citri psyllid: psy14757


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
PFADAFKGSEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNGTVIEVSRDTFPLCDFYRATPSRGKNRVGGNPP
ccccccccccccccccEEEEEEEECcccEEEEEECcccccccHHHHHHHHHHccccccEEECcccccccCEEEEEccccccccccccccc
************VQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNGTVIEVSRDTFPLCDFYRA**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PFADAFKGSEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNGTVIEVSRDTFPLCDFYRATPSRGKNRVGGNPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein translation factor SUI1 homolog Probably involved in translation.very confidentP42678
Protein translation factor SUI1 homolog Probably involved in translation.very confidentQ9VZS3
Protein translation factor sui1 Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation.confidentP79060

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071456 [BP]cellular response to hypoxiaprobableGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0043614 [CC]multi-eIF complexprobableGO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044424, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006413 [BP]translational initiationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IF1, chain A
Confidence level:very confident
Coverage over the Query: 1-77
View the alignment between query and template
View the model in PyMOL