>gi|350401769|ref|XP_003486256.1| PREDICTED: protein translation factor SUI1 homolog [Bombus impatiens] gi|307207800|gb|EFN85418.1| Protein translation factor SUI1-like protein [Harpegnathos saltator] gi|332024011|gb|EGI64229.1| Protein translation factor SUI1-like protein [Acromyrmex echinatior]
eIF1/SUI1 (eukaryotic initiation factor 1) plays an important role in accurate initiator codon recognition during translation initiation. eIF1 interacts with 18S rRNA in the 40S ribosomal subunit during eukaryotic translation initiation. Point mutations in the yeast eIF1 implicate the protein in maintaining accurate start-site selection but its mechanism of action is unknown. Length = 84
Alternate name: MOF2. A similar protein family (see TIGRFAMs model TIGR01158) is found in prokaryotes. The human proteins complements a yeast SUI1 mutatation [Protein synthesis, Translation factors]. Length = 110
Members of the eIF1/SUI1 (eukaryotic initiation factor 1) family are found in eukaryotes, archaea, and some bacteria; eukaryotic members are understood to play an important role in accurate initiator codon recognition during translation initiation. eIF1 interacts with 18S rRNA in the 40S ribosomal subunit during eukaryotic translation initiation. Point mutations in the yeast eIF1 implicate the protein in maintaining accurate start-site selection but its mechanism of action is unknown. The function of non-eukaryotic family members is also unclear. Length = 78
>gnl|CDD|211320 cd11607, DENR_C, C-terminal domain of DENR and related proteins
DENR (density regulated protein), together with MCT-1 (multiple copies T cell malignancies), has been shown to have similar function as eIF2D translation initiation factor (also known as ligatin), which is involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. Length = 86
Score = 39.6 bits (93), Expect = 2e-05
Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 4/54 (7%)
Query: 10 EDDVQDGLVHIRIQQRNGR--KTLTTVQGLS-SEYDLKKIVRACKKEFACNGTV 60
+D +V I+ + R GR K +T ++GL S+ DLK++ + K + C GTV
Sbjct: 18 AKPKEDQVVRIQRETR-GRKGKGVTIIEGLDLSDIDLKELAKELKSKCGCGGTV 70
This family of archaeal and bacterial proteins is homologous to the eukaryotic translation intiation factor SUI1 involved in directing the ribosome to the proper start site of translation by functioning in concert with eIF-2 and the initiator tRNA-Met [Protein synthesis, Translation factors]. Length = 101
>gnl|CDD|211321 cd11608, eIF2D_C, C-terminal domain of eIF2D and related proteins
Score = 37.2 bits (87), Expect = 9e-05
Identities = 12/48 (25%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
Query: 18 VHIRIQQRNGRKTLTTVQGLSS-EYDLKKIVRACKKEFACNGTVIEVS 64
+ I ++R G K +T + GL S D ++ + +K+ A + +V +
Sbjct: 2 IDITTERRQGNKKVTLISGLESFGIDPEEFAKELQKKCAASTSVSPLP 49
eIF2D translation initiation factor (also known as ligatin) is involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. Length = 85
Score = 34.4 bits (80), Expect = 7e-04
Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
Query: 16 GLVHIRIQQR-NGRKTLTTVQGLS-SEYDLKKIVRACKKEFACNGTVIE 62
V +R+++R G KT+T ++GL SE DLK++ + KK+ C GTV +
Sbjct: 1 QKVRVRLEKRGRGGKTVTVIEGLPLSEEDLKELAKELKKKCGCGGTVKD 49
Members of the eIF1/SUI1 (eukaryotic initiation factor 1) family are found in eukaryotes, archaea, and some bacteria; eukaryotic members are understood to play an important role in accurate initiator codon recognition during translation initiation. The function of non-eukaryotic family members is unclear. Escherichia coli YciH is a non-essential protein and was reported to be able to perform some of the functions of IF3 in prokaryotic initiation. Length = 76
Alternate name: MOF2. A similar protein family (see TIGRFAMs model TIGR01158) is found in prokaryotes. The human proteins complements a yeast SUI1 mutatation.
>COG0023 SUI1 Translation initiation factor 1 (eIF-1/SUI1) and related proteins [Translation, ribosomal structure and biogenesis]
>cd00474 SUI1_eIF1 The SUI1/eIF1 (eukaryotic initiation factor 1) fold is found in eukaryotes, archaea, and some bacteria and is thought to play an important role in accurate initiator codon recognition during translation initiation
This fold, which includes two antiparallel alpha helices packed against the same side of a five-strand beta sheet, is structurally similar to other RNA-binding domains suggesting that SUI1/eIF1 may bind RNA. Point mutations in the yeast eIF1 implicate the protein in maintaining accurate start-site selection but its mechanism of action is unknown.
>PF01253 SUI1: Translation initiation factor SUI1; InterPro: IPR001950 In Saccharomyces cerevisiae (Baker's yeast), SUI1 is a translation initiation factor that functions in concert with eIF-2 and the initiator tRNA-Met in directing the ribosome to the proper start site of translation []
SUI1 is a protein of 108 residues. Close homologs of SUI1 have been found [] in mammals, insects and plants. SUI1 is also evolutionary related to hypothetical proteins from Escherichia coli (yciH), Haemophilus influenzae (HI1225) and Methanococcus vannielii.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2OGH_A 1D1R_A 2IF1_A 2XZN_F 2XZM_F.
This family of archaeal and bacterial proteins is homologous to the eukaryotic translation intiation factor SUI1 involved in directing the ribosome to the proper start site of translation by functioning in concert with eIF-2 and the initiator tRNA-Met.
>pdb|2XZM|F Chain F, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 101