Diaphorina citri psyllid: psy14758


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MQERVWSSDLFMLDPFADAFKGSEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKKRFSTFYLSALSKCDPQKVGTYKIFATETLVTSSELKLSLGNLFQASCLGVNRAGMLLKCFLCDKRSC
ccccccccccccccccccccccccccccccEEEEEEEECcccEEEEEECcccccccHHHHHHHHHHcccccccccCEEEccccccHHHHHHHHccccccccEEEEEccEEEEEEccccccccccHHEEcccccc
*****WS**LFMLDPFADA***SEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKKRFSTFYLSALSKCDPQKVGTYKIFATETLVTSSELKLSLGNLFQASCLGVNRAGMLLKCFLCDKRS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQERVWSSDLFMLDPFADAFKGSEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKKRFSTFYLSALSKCDPQKVGTYKIFATETLVTSSELKLSLGNLFQASCLGVNRAGMLLKCFLCDKRSC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein translation factor SUI1 homolog Probably involved in translation.confidentP42678
Protein translation factor SUI1 homolog Probably involved in translation.confidentQ9VZS3
Eukaryotic translation initiation factor 1 Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.confidentP41567

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0071456 [BP]cellular response to hypoxiaprobableGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0043614 [CC]multi-eIF complexprobableGO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044424, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IF1, chain A
Confidence level:very confident
Coverage over the Query: 5-68,79-81,94-131
View the alignment between query and template
View the model in PyMOL