Diaphorina citri psyllid: psy14765

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTELHTDDGNY
ccHHHHHHHHHHHHHHcccccccccccEEcccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEcHHHHHcccccccCECccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccCEEEcccccccCCcccccccccccccccEECccccccccccc
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTEL*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTELHTDDGNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048019 [MF]receptor antagonist activityprobableGO:0030545, GO:0030547, GO:0003674, GO:0005488, GO:0005515, GO:0005102
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VQ2, chain A
Confidence level:very confident
Coverage over the Query: 27-223
View the alignment between query and template
View the model in PyMOL
Template: 2Z80, chain A
Confidence level:very confident
Coverage over the Query: 26-218
View the alignment between query and template
View the model in PyMOL
Template: 2IFG, chain A
Confidence level:confident
Coverage over the Query: 23-254
View the alignment between query and template
View the model in PyMOL