Psyllid ID: psy14765


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTELHTDDGNY
ccHHHHHHHHHHHHHHcccccccccccEEcccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEcHHHHHcccccccEEEcccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccccccEEcccccccccccccccEEEccccccccccc
ccHHHHHHHHHHHHHHcccccccccccEEccccccEEEEEccccccEcccccccccEEEEcccccEEEccHHHHHHccccccEEEEEccccccEccHHHHccccccEEEEccccccEEccccccHHHHHEEEcccccccEcccHHHcccccccEEEcccccccEcccHHHHHcHccccccccccccEEccccccccccccHHHHHHHHHcccccccccccccccHHHcccccccccccccccccccccccccccEEEcccccccccccc
MCHKFILSVFLLTLLASvtqascplgcsckwkagkrtvecidrnfytipegidldtqvLDLSSNNINVLQKEIFLQMGITNIQKLYLRKcklefvddrafrgvtnmdeldlsdnllstvpsliyipylksinlahnpinqissysfqstpgiryidmsncqihtIYSEAFYVMvlpgsnltldcrvqsatpcriMWSINRKIYDhvnwnsnkinikeetvlskdnsylSVFSGGvdlaaasspggeniydqkstltvfdtelhtddgny
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGgeniydqkstltvfdtelhtddgny
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTELHTDDGNY
**HKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAA***************LTV************
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTEL*******
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTELHTDDGNY
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTELHT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSINRKIYDHVNWNSNKINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKSTLTVFDTELHTDDGNY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q8C031 640 Leucine-rich repeat-conta yes N/A 0.557 0.234 0.307 5e-17
Q9HCJ2 640 Leucine-rich repeat-conta yes N/A 0.557 0.234 0.307 5e-17
Q9NT99 713 Leucine-rich repeat-conta no N/A 0.565 0.213 0.316 1e-16
P0C192 709 Leucine-rich repeat-conta no N/A 0.565 0.214 0.316 2e-16
P0CC10 709 Leucine-rich repeat-conta no N/A 0.565 0.214 0.316 2e-16
Q9HBW1 653 Leucine-rich repeat-conta no N/A 0.542 0.223 0.302 3e-14
Q45R42 652 Leucine-rich repeat-conta no N/A 0.542 0.223 0.302 3e-14
Q99PH1 652 Leucine-rich repeat-conta no N/A 0.542 0.223 0.302 3e-14
Q9WVB4 1523 Slit homolog 3 protein OS no N/A 0.576 0.101 0.269 2e-13
Q504C1 561 Leucine-rich repeat, immu no N/A 0.617 0.295 0.267 2e-13
>sp|Q8C031|LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus GN=Lrrc4c PE=1 SV=2 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 87/156 (55%), Gaps = 6/156 (3%)

Query: 18  VTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQM 77
           V   +CP  CSC  +  K  V C+ +N   +P+GI  +T++L+L  N I +++   F  +
Sbjct: 42  VRAQTCPSVCSCSNQFSK--VICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHL 99

Query: 78  GITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVP--SLIYIPYLKSINLAH 135
              +++ L L +  +  ++  AF G+ N++ L+L DN L+T+P  + +Y+  LK + L +
Sbjct: 100 --RHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRN 157

Query: 136 NPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFY 171
           NPI  I SY+F   P +R +D+   +  +  SE  +
Sbjct: 158 NPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAF 193




May promote neurite outgrowth of developing thalamic neurons.
Mus musculus (taxid: 10090)
>sp|Q9HCJ2|LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens GN=LRRC4C PE=1 SV=1 Back     alignment and function description
>sp|Q9NT99|LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens GN=LRRC4B PE=2 SV=3 Back     alignment and function description
>sp|P0C192|LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus GN=Lrrc4b PE=1 SV=1 Back     alignment and function description
>sp|P0CC10|LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus GN=Lrrc4b PE=1 SV=1 Back     alignment and function description
>sp|Q9HBW1|LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens GN=LRRC4 PE=1 SV=2 Back     alignment and function description
>sp|Q45R42|LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus GN=Lrrc4 PE=1 SV=1 Back     alignment and function description
>sp|Q99PH1|LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus GN=Lrrc4 PE=1 SV=2 Back     alignment and function description
>sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 Back     alignment and function description
>sp|Q504C1|LRIT2_DANRE Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 OS=Danio rerio GN=lrit2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
91081765 605 PREDICTED: similar to kek1 [Tribolium ca 0.858 0.381 0.400 3e-42
328715086 748 PREDICTED: hypothetical protein LOC10016 0.568 0.204 0.483 5e-42
383858349 627 PREDICTED: leucine-rich repeat-containin 0.628 0.269 0.477 4e-39
66499167 630 PREDICTED: leucine-rich repeat-containin 0.617 0.263 0.440 1e-38
380012878 612 PREDICTED: leucine-rich repeat-containin 0.635 0.279 0.433 1e-38
195176173 817 GL10073 [Drosophila persimilis] gi|19411 0.583 0.192 0.496 2e-38
198472318 886 GA11531 [Drosophila pseudoobscura pseudo 0.583 0.177 0.496 3e-38
20152123 810 SD01674p [Drosophila melanogaster] 0.561 0.186 0.503 6e-38
77455258 864 CG12283 [Drosophila simulans] 0.561 0.174 0.503 6e-38
77455256 864 CG12283 [Drosophila simulans] 0.561 0.174 0.503 6e-38
>gi|91081765|ref|XP_973226.1| PREDICTED: similar to kek1 [Tribolium castaneum] gi|270006351|gb|EFA02799.1| kekkon-1 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 158/252 (62%), Gaps = 21/252 (8%)

Query: 21  ASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGIT 80
            +CP  C+CKWK GK+TVEC +R   TIPE +D +TQVLDLS NN+ +L +E F++ G+ 
Sbjct: 19  GNCPSPCTCKWKGGKQTVECTERGLITIPESVDPETQVLDLSGNNLQILPRETFVRSGLL 78

Query: 81  NIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIY--IPYLKSINLAHNPI 138
           N+Q+++LR+C++  +DD AFRG+TN+ ELDLS NLL+ VPS  +  +P+L+ + LA+NPI
Sbjct: 79  NLQRVFLRRCRIGQIDDLAFRGLTNLIELDLSHNLLTAVPSGTFRDVPFLRDLVLAYNPI 138

Query: 139 NQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPGSNLTLDCRVQSATPCRIMWSI 198
            +I S +F++ PG+  +D+SNC+I  I S+AF  + +  S L L+    S    R + ++
Sbjct: 139 QKIDSQAFKTIPGLIKLDLSNCEIQVIASKAFEGIEMLES-LKLNGNRLSELRLRTVETL 197

Query: 199 NR--KIYDHVN-WNSN-KINIKEETVLSKDNSYLSVFSGGVDLAAASSPGGENIYDQKST 254
           NR   I  H N W+ + ++   +E +++ +  Y         ++   S G E + D+   
Sbjct: 198 NRLHGIEMHDNPWHCDCRLRAVKEWLVNNNIPY--------PISPICSGGPERLIDK--- 246

Query: 255 LTVFDTELHTDD 266
              F TELH DD
Sbjct: 247 --TF-TELHIDD 255




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328715086|ref|XP_003245526.1| PREDICTED: hypothetical protein LOC100160315 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383858349|ref|XP_003704664.1| PREDICTED: leucine-rich repeat-containing protein 4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66499167|ref|XP_624568.1| PREDICTED: leucine-rich repeat-containing protein 24 [Apis mellifera] Back     alignment and taxonomy information
>gi|380012878|ref|XP_003690501.1| PREDICTED: leucine-rich repeat-containing protein 4B-like [Apis florea] Back     alignment and taxonomy information
>gi|195176173|ref|XP_002028708.1| GL10073 [Drosophila persimilis] gi|194111221|gb|EDW33264.1| GL10073 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198472318|ref|XP_001355897.2| GA11531 [Drosophila pseudoobscura pseudoobscura] gi|198138961|gb|EAL32956.2| GA11531 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|20152123|gb|AAM11421.1| SD01674p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|77455258|gb|ABA86438.1| CG12283 [Drosophila simulans] Back     alignment and taxonomy information
>gi|77455256|gb|ABA86437.1| CG12283 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
FB|FBgn0015399 880 kek1 "kekkon-1" [Drosophila me 0.561 0.171 0.503 5.4e-37
FB|FBgn0015400 894 kek2 "kekkon-2" [Drosophila me 0.602 0.181 0.448 2.8e-31
FB|FBgn0028370 1021 kek3 "kekkon-3" [Drosophila me 0.609 0.160 0.386 3.3e-29
FB|FBgn0039862 836 kek6 "kek6" [Drosophila melano 0.598 0.192 0.319 1.1e-25
ZFIN|ZDB-GENE-050522-533 647 lrrc4c "leucine rich repeat co 0.602 0.250 0.339 3.5e-20
FB|FBgn0032484 649 kek4 "kekkon4" [Drosophila mel 0.661 0.274 0.298 1e-19
UNIPROTKB|E2REC5 639 LRRC4C "Uncharacterized protei 0.598 0.251 0.315 1.1e-18
UNIPROTKB|F1SHH6 640 LRRC4C "Uncharacterized protei 0.598 0.251 0.315 1.1e-18
UNIPROTKB|F1MXH5 640 LRRC4C "Uncharacterized protei 0.598 0.251 0.315 1.1e-18
UNIPROTKB|Q9HCJ2 640 LRRC4C "Leucine-rich repeat-co 0.598 0.251 0.315 1.1e-18
FB|FBgn0015399 kek1 "kekkon-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 407 (148.3 bits), Expect = 5.4e-37, P = 5.4e-37
 Identities = 77/153 (50%), Positives = 108/153 (70%)

Query:    20 QASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGI 79
             Q++C   C+CKWK GK+TVECIDR+   IPE ID +TQVLD+S N +  L  E F++  +
Sbjct:    87 QSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANL 146

Query:    80 TNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLI--YIPYLKSINLAHNP 137
              N+QKLYLR CK+  ++   F+G+TN+ ELDLS NLL TVPSL   +IP L+ + LA N 
Sbjct:   147 LNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNH 206

Query:   138 INQISSYSFQSTPGIRYIDMSNCQIHTIYSEAF 170
             I++I S +F +TP +  +D+S+C I TI ++AF
Sbjct:   207 IHKIESQAFGNTPSLHKLDLSHCDIQTISAQAF 239




GO:0005887 "integral to plasma membrane" evidence=ISM
GO:0048477 "oogenesis" evidence=IMP
GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IGI;IMP;TAS
GO:0005154 "epidermal growth factor receptor binding" evidence=IPI
GO:0007175 "negative regulation of epidermal growth factor-activated receptor activity" evidence=IDA;TAS
GO:0016021 "integral to membrane" evidence=TAS
GO:0000910 "cytokinesis" evidence=IMP
GO:0048019 "receptor antagonist activity" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
FB|FBgn0015400 kek2 "kekkon-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0028370 kek3 "kekkon-3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039862 kek6 "kek6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-533 lrrc4c "leucine rich repeat containing 4C" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0032484 kek4 "kekkon4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2REC5 LRRC4C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHH6 LRRC4C "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXH5 LRRC4C "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCJ2 LRRC4C "Leucine-rich repeat-containing protein 4C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 50.6 bits (122), Expect = 7e-09
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 57  QVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLL 116
           + LDLS+N + V+    F  +   N++ L L    L  +   AF G+ ++  LDLS N L
Sbjct: 3   KSLDLSNNRLTVIPDGAFKGL--PNLKVLDLSGNNLTSISPEAFSGLPSLRSLDLSGNNL 60


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 6e-18
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-17
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-17
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 3e-15
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 4e-11
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-10
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-10
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-09
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 2e-09
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 3e-09
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 3e-09
2xot_A 361 Crystal Structure Of Neuronal Leucine Rich Repeat P 7e-09
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-08
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 2e-08
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 3e-08
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 4e-08
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 5e-08
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 6e-08
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 6e-08
2z63_A 570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 7e-08
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 7e-08
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 8e-08
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-08
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-04
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-07
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 1e-07
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-07
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 2e-07
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 4e-07
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 6e-07
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 6e-07
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 8e-07
3a79_A 580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-06
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 2e-06
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 2e-06
2z81_A 549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 2e-06
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-06
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 8e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 8e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 7e-05
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 8e-05
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-04
3rg1_A 612 Crystal Structure Of The Rp105MD-1 Complex Length = 3e-04
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure

Iteration: 1

Score = 87.8 bits (216), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 47/152 (30%), Positives = 86/152 (56%), Gaps = 6/152 (3%) Query: 22 SCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITN 81 +CP CSC + K V C+ +N +P+GI +T++L+L N I +++ F + + Sbjct: 34 TCPSVCSCSNQFSK--VICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHL--RH 89 Query: 82 IQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVP--SLIYIPYLKSINLAHNPIN 139 ++ L L + + ++ AF G+ N++ L+L DN L+T+P + +Y+ LK + L +NPI Sbjct: 90 LEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIE 149 Query: 140 QISSYSFQSTPGIRYIDMSNCQIHTIYSEAFY 171 I SY+F P +R +D+ + + SE + Sbjct: 150 SIPSYAFNRIPSLRRLDLGELKRLSYISEGAF 181
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-38
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-35
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-34
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-29
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-24
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-20
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-14
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 8e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-04
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
 Score =  136 bits (344), Expect = 3e-38
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 7/159 (4%)

Query: 14  LLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEI 73
           L +  +  SCP  C C        + C  +    +P+ +   T +LDLS NN++ L+ E 
Sbjct: 3   LASGRSVVSCPANCLC----ASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEW 58

Query: 74  FLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPS--LIYIPYLKSI 131
                +TN+  L L    L F+   AF  V N+  LDLS N L T+       +  L+ +
Sbjct: 59  TPT-RLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVL 117

Query: 132 NLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAF 170
            L +N I  +   +F+    ++ + +S  QI     E  
Sbjct: 118 LLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELI 156


>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.97
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.94
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.92
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.89
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.81
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.81
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.79
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.78
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.78
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.75
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.74
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.72
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.71
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.71
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.7
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.68
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.67
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.67
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.62
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.62
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.62
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.61
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.59
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.58
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.53
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.4
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.32
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.26
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.25
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.86
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.84
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.6
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.42
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.25
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.25
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 98.25
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.24
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.22
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.16
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.82
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.8
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.72
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 93.06
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 84.98
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 82.03
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 81.69
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
Probab=99.97  E-value=1.4e-29  Score=207.36  Aligned_cols=171  Identities=20%  Similarity=0.413  Sum_probs=160.6

Q ss_pred             CCCCCCCCeEeeeCCCcEEEcCCCCCcccCCCCCCCceEEEeecCCccccccccccccCCCcccEEEcccccccccchhh
Q psy14765         20 QASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRA   99 (269)
Q Consensus        20 ~~~cp~~C~C~~~~~~~~v~c~~~~l~~ip~~~~~~l~~L~l~~n~l~~i~~~~f~~~~l~~L~~L~L~~N~i~~~~~~~   99 (269)
                      +.+||..|+|.    ...|+|++++++++|..++++++.|++++|.|+.+++..|.  ++++|+.|++++|+|+.+.+.+
T Consensus         2 ~~~CP~~C~C~----~~~v~c~~~~l~~iP~~l~~~l~~L~l~~n~i~~i~~~~~~--~l~~L~~L~Ls~N~i~~~~~~~   75 (220)
T 2v9t_B            2 SLHCPAACTCS----NNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFS--PYKKLRRIDLSNNQISELAPDA   75 (220)
T ss_dssp             CCCSCTTSEEE----TTEEECTTSCCSSCCSSCCTTCCEEECCSSCCCEECTTSST--TCTTCCEEECCSSCCCEECTTT
T ss_pred             CCCCCCCCEEC----CCEEEcCCCCcCcCCCccCcCCCEEECCCCcCCCcCHhHhh--CCCCCCEEECCCCcCCCcCHHH
Confidence            45899999998    68999999999999999999999999999999999999998  8999999999999999999999


Q ss_pred             hcCCCCCCEEEcCCCCCCCcCCccC--ccccceeecCCCcccccCccccCCCCCCCEEEccCCcceeeCcccccccccCC
Q psy14765        100 FRGVTNMDELDLSDNLLSTVPSLIY--IPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLPG  177 (269)
Q Consensus       100 ~~~l~~L~~L~L~~N~l~~l~~~~~--l~~L~~L~L~~N~i~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~~l  177 (269)
                      |.++++|++|+|++|.|+.++...|  +++|+.|+|++|+|+++.+..|..+++|+.|+|++|++++++++.|..++. +
T Consensus        76 ~~~l~~L~~L~Ls~N~l~~l~~~~f~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~-L  154 (220)
T 2v9t_B           76 FQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRA-I  154 (220)
T ss_dssp             TTTCSSCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCSCCCTTTTTTCTT-C
T ss_pred             hhCCcCCCEEECCCCcCCccCHhHccCCCCCCEEECCCCCCCEeCHHHcCCCCCCCEEECCCCcCCEECHHHHhCCCC-C
Confidence            9999999999999999999999887  999999999999999999999999999999999999999999998988876 7


Q ss_pred             CeeEEeeccccCCCcccccee
Q psy14765        178 SNLTLDCRVQSATPCRIMWSI  198 (269)
Q Consensus       178 ~~l~l~~n~~~~~~~~~~~~~  198 (269)
                      +.+.+++|++. +.|.+.|+.
T Consensus       155 ~~L~L~~N~~~-c~c~l~~l~  174 (220)
T 2v9t_B          155 QTMHLAQNPFI-CDCHLKWLA  174 (220)
T ss_dssp             CEEECCSSCEE-CSGGGHHHH
T ss_pred             CEEEeCCCCcC-CCCccHHHH
Confidence            99999999965 467888874



>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 80.5 bits (197), Expect = 3e-18
 Identities = 33/155 (21%), Positives = 62/155 (40%), Gaps = 7/155 (4%)

Query: 22  SCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITN 81
            CP  C C      R V+C D     +P+ +  DT +LDL +N I  ++   F  +   N
Sbjct: 3   VCPFRCQCHL----RVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNL--KN 56

Query: 82  IQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPINQI 141
           +  L L   K+  +   AF  +  ++ L LS N L  +P  +     + + +  N I ++
Sbjct: 57  LHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTL-QELRVHENEITKV 115

Query: 142 SSYSFQSTPGIRYIDMSNCQIHTIYSEAFYVMVLP 176
               F     +  +++    + +   E      + 
Sbjct: 116 RKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMK 150


>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.95
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.49
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.43
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.2
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.47
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.99
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.98
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.97
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.57
d2ifga192 High affinity nerve growth factor receptor TrkA, d 89.08
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 83.31
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 83.03
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 81.61
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 80.52
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 80.02
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.95  E-value=1.1e-27  Score=190.00  Aligned_cols=140  Identities=26%  Similarity=0.511  Sum_probs=132.5

Q ss_pred             CCCCCCeEeeeCCCcEEEcCCCCCcccCCCCCCCceEEEeecCCcc-ccccccccccCCCcccEEEcccccccccchhhh
Q psy14765         22 SCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNIN-VLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAF  100 (269)
Q Consensus        22 ~cp~~C~C~~~~~~~~v~c~~~~l~~ip~~~~~~l~~L~l~~n~l~-~i~~~~f~~~~l~~L~~L~L~~N~i~~~~~~~~  100 (269)
                      .||..|.|.    .++|+|+++++++||.++++++++|++++|+|+ .++...|.  ++++|+.|++++|+++.++++.|
T Consensus         1 ~CP~~C~C~----~~~v~Cs~~~L~~iP~~lp~~l~~L~Ls~N~i~~~~~~~~f~--~l~~L~~L~L~~N~i~~~~~~~~   74 (192)
T d1w8aa_           1 DCPAMCHCE----GTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFG--RLPHLVKLELKRNQLTGIEPNAF   74 (192)
T ss_dssp             CCCTTSEEE----TTEEECTTSCCSSCCSCCCTTCSEEECCSCCCCSBCCSCSGG--GCTTCCEEECCSSCCCCBCTTTT
T ss_pred             CcCCCCEEc----CCEEEEeCCCcCccCCCCCCCCCEEEeCCCCCcccccccccC--CCceEeeeecccccccccccccc
Confidence            499999998    679999999999999999999999999999998 57788898  89999999999999999999999


Q ss_pred             cCCCCCCEEEcCCCCCCCcCCccC--ccccceeecCCCcccccCccccCCCCCCCEEEccCCcceeeCc
Q psy14765        101 RGVTNMDELDLSDNLLSTVPSLIY--IPYLKSINLAHNPINQISSYSFQSTPGIRYIDMSNCQIHTIYS  167 (269)
Q Consensus       101 ~~l~~L~~L~L~~N~l~~l~~~~~--l~~L~~L~L~~N~i~~~~~~~~~~l~~L~~L~L~~N~l~~~~~  167 (269)
                      ..+++|++|+|++|+|+.+++.+|  +++|++|+|++|+|+++++++|..+++|++++|++|.+.....
T Consensus        75 ~~~~~L~~L~Ls~N~l~~l~~~~F~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~l~L~~N~~~~~~~  143 (192)
T d1w8aa_          75 EGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCH  143 (192)
T ss_dssp             TTCTTCCEEECCSCCCCEECSSSSTTCTTCCEEECCSSCCCEECTTSSTTCTTCCEEECTTCCBCCSGG
T ss_pred             ccccccceeeeccccccccCHHHHhCCCcccccccCCccccccCHHHhcCCcccccccccccccccccc
Confidence            999999999999999999999998  9999999999999999999999999999999999999886543



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure