Diaphorina citri psyllid: psy14767


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPIHQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYGIDKIDTLKLNGNKLASLKPRTWS
ccHHHHHHHHHHHHHHcccccccccccEEcccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccCEccHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEccccccEECcccHHcccccccEEEccccccccccccccc
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPIHQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYGIDKIDTLKLNGNKLASLKP*TWS
xxxxxxxxxxxHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCHKFILSVFLLTLLASVTQASCPLGCSCKWKAGKRTVECIDRNFYTIPEGIDLDTQVLDLSSNNINVLQKEIFLQMGITNIQKLYLRKCKLEFVDDRAFRGVTNMDELDLSDNLLSTVPSLIYIPYLKSINLAHNPIHQISSYSFQSTPGIRYIDMSNCQIHTIYSEAFYGIDKIDTLKLNGNKLASLKPRTWS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048019 [MF]receptor antagonist activityprobableGO:0030545, GO:0030547, GO:0003674, GO:0005488, GO:0005515, GO:0005102
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z63, chain A
Confidence level:very confident
Coverage over the Query: 25-193
View the alignment between query and template
View the model in PyMOL
Template: 2Z80, chain A
Confidence level:very confident
Coverage over the Query: 20-189
View the alignment between query and template
View the model in PyMOL