Diaphorina citri psyllid: psy14771


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60----
MDGDEVLLFERATFLVISHCQRKEHRDIHRFEKISNIIKQFKLSSKWLPRFIQWKYATLSLQRS
cccEEEEEEEcEEEEEEEEECccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEc
MDGDEVLLFERATFLVISHCQRKEHRDIHRFEKISNIIKQFKLSSKWLPRFIQWKYATLSLQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGDEVLLFERATFLVISHCQRKEHRDIHRFEKISNIIKQFKLSSKWLPRFIQWKYATLSLQRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related GTP-binding protein A Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity. Required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Involved in the RCC1/Ran-GTPase pathway. Involved in the RCC1/Ran-GTPase pathway. May play a direct role in a TNF-alpha signaling pathway leading to induction of cell death.confidentQ63486
Ras-related GTP-binding protein A confidentQ54IK1
Ras-related GTP-binding protein A Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity. Required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Involved in the RCC1/Ran-GTPase pathway. Involved in the RCC1/Ran-GTPase pathway. May play a direct role in a TNF-alpha signaling pathway leading to induction of cell death.confidentQ80X95

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051219 [MF]phosphoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045919 [BP]positive regulation of cytolysisprobableGO:0042268, GO:0050794, GO:0048518, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0032008 [BP]positive regulation of TOR signaling cascadeprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008150, GO:0023051, GO:0048518, GO:0032006, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0019048 [BP]virus-host interactionprobableGO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0008219 [BP]cell deathprobableGO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071230 [BP]cellular response to amino acid stimulusprobableGO:1901700, GO:0043200, GO:0051716, GO:0009719, GO:1901701, GO:1901698, GO:0071417, GO:1901699, GO:0008150, GO:0044699, GO:0071229, GO:0071495, GO:0071310, GO:0044763, GO:0001101, GO:0070887, GO:0050896, GO:0042221, GO:0009987, GO:0010243, GO:0010033
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010506 [BP]regulation of autophagyprobableGO:0009894, GO:0031329, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009267 [BP]cellular response to starvationprobableGO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0030307 [BP]positive regulation of cell growthprobableGO:0045927, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0032504 [BP]multicellular organism reproductionprobableGO:0032501, GO:0008150, GO:0000003
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R7W, chain A
Confidence level:very confident
Coverage over the Query: 1-58
View the alignment between query and template
View the model in PyMOL