Diaphorina citri psyllid: psy14772


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MDTGEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDQVQYYFQLAQQHQAALQQNNQGATTTSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS
cccHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHccccccc
*********NRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPRE**********************QVQYYFQLA***********************VV********QIQTIPMLLPLRTTYK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTGEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDQVQYYFQLAQQHQAALQQNNQGATTTSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear transcription factor Y subunit gamma Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.confidentQ5RA23
Nuclear transcription factor Y subunit C-4 Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway.confidentQ9FMV5
Nuclear transcription factor Y subunit gamma Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.confidentQ13952

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0016602 [CC]CCAAT-binding factor complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0071248 [BP]cellular response to metal ionprobableGO:0051716, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0009738 [BP]abscisic acid mediated signaling pathwayprobableGO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0044699, GO:0009755, GO:0051716, GO:0009737, GO:0033993, GO:0071310, GO:0065007, GO:0071215, GO:0071495, GO:0009719, GO:1901701, GO:0009987, GO:0071396, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0010033, GO:1901700, GO:0044700, GO:0009725, GO:0050896, GO:0008150, GO:0097305, GO:0097306
GO:0031669 [BP]cellular response to nutrient levelsprobableGO:0031668, GO:0071496, GO:0009605, GO:0050896, GO:0009987, GO:0051716, GO:0031667, GO:0008150, GO:0044763, GO:0044699, GO:0007154, GO:0009991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G92, chain C
Confidence level:very confident
Coverage over the Query: 4-101
View the alignment between query and template
View the model in PyMOL