Psyllid ID: psy14772

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MDTGEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDQVQYYFQLAQQHQAALQQNNQGATTTSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS
cccHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHccccccc
ccHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHccccccccEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHcccHHHHHHccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccEEEEEEEcc
MDTGEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIdivpreevktatgphrrddatktalnpdqVQYYFQLAQQHQAALQQnnqgatttsatptlvvnggnsgaqqiqtipmllplrttykltqhkefs
mdtgekehvnrviqvteldlktqalpLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIrawihtednkrrtlqrNDIAMAITKYDMFDFLIDIVPReevktatgphrrddatktALNPDQVQYYFQLAQQHQAALQQNNQGATTTSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS
MDTGEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDqvqyyfqlaqqhqaalqqnnqgaTTTSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS
*********NRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPRE**********************QVQYYFQLA***********************VV********QIQTIPMLLPLRTTYK********
***********************ALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIR***************NDIAMAITKYDMFDFLIDIVP******************************************************************************************
********VNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDQVQYYFQLAQQ**************TSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS
MDTGEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVK*****************PDQVQYYFQLAQQHQAALQQNNQGATTTSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTGEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDQVQYYFQLAQQHQAALQQNNQGATTTSATPTLVVNGGNSGAQQIQTIPMLLPLRTTYKLTQHKEFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q5RA23 335 Nuclear transcription fac yes N/A 0.617 0.352 0.702 2e-44
Q13952 458 Nuclear transcription fac yes N/A 0.612 0.255 0.696 2e-44
Q62725 335 Nuclear transcription fac yes N/A 0.612 0.349 0.696 5e-44
P70353 335 Nuclear transcription fac yes N/A 0.612 0.349 0.696 5e-44
Q5E9X1 335 Nuclear transcription fac yes N/A 0.612 0.349 0.696 6e-44
Q9FMV5250 Nuclear transcription fac yes N/A 0.460 0.352 0.738 4e-34
Q9SMP0234 Nuclear transcription fac no N/A 0.460 0.376 0.727 3e-33
Q8LCG7199 Nuclear transcription fac no N/A 0.460 0.442 0.704 1e-32
Q9ZVL3217 Nuclear transcription fac no N/A 0.460 0.405 0.670 7e-32
Q8L4B2231 Nuclear transcription fac no N/A 0.460 0.380 0.670 1e-31
>sp|Q5RA23|NFYC_PONAB Nuclear transcription factor Y subunit gamma OS=Pongo abelii GN=NFYC PE=2 SV=1 Back     alignment and function desciption
 Score =  178 bits (452), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (82%), Gaps = 3/121 (2%)

Query: 19  DLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTL 78
           D + Q LPLARIKKIMKLD+ VKMISAEAP+LF+KAA++FI ELT+RAWIHTEDNKRRTL
Sbjct: 37  DFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTL 96

Query: 79  QRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDQVQYYFQLAQQHQ 138
           QRNDIAMAITK+D FDFLIDIVPR+E+K    P R++D  ++    + VQYYF LAQQ  
Sbjct: 97  QRNDIAMAITKFDQFDFLIDIVPRDELKP---PKRQEDVRQSVTPAEPVQYYFTLAQQPA 153

Query: 139 A 139
           A
Sbjct: 154 A 154
Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
Pongo abelii (taxid: 9601)
>sp|Q13952|NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens GN=NFYC PE=1 SV=3 Back     alignment and function description
>sp|Q62725|NFYC_RAT Nuclear transcription factor Y subunit gamma OS=Rattus norvegicus GN=Nfyc PE=2 SV=1 Back     alignment and function description
>sp|P70353|NFYC_MOUSE Nuclear transcription factor Y subunit gamma OS=Mus musculus GN=Nfyc PE=2 SV=2 Back     alignment and function description
>sp|Q5E9X1|NFYC_BOVIN Nuclear transcription factor Y subunit gamma OS=Bos taurus GN=NFYC PE=2 SV=1 Back     alignment and function description
>sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 Back     alignment and function description
>sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZVL3|NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana GN=NFYC3 PE=2 SV=1 Back     alignment and function description
>sp|Q8L4B2|NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana GN=NFYC9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
307202922 340 Nuclear transcription factor Y subunit g 0.827 0.464 0.660 2e-52
66498993 346 PREDICTED: nuclear transcription factor 0.827 0.456 0.648 4e-52
380013245 346 PREDICTED: LOW QUALITY PROTEIN: nuclear 0.821 0.453 0.652 4e-52
307180253 323 Nuclear transcription factor Y subunit g 0.816 0.482 0.640 1e-51
383860596 323 PREDICTED: nuclear transcription factor 0.827 0.489 0.648 2e-51
350425504 346 PREDICTED: LOW QUALITY PROTEIN: nuclear 0.848 0.468 0.633 2e-51
340728976 323 PREDICTED: nuclear transcription factor 0.827 0.489 0.648 3e-51
332022675 295 Nuclear transcription factor Y subunit g 0.816 0.528 0.654 8e-51
242247387 338 nuclear transcription factor Y, gamma-li 0.628 0.355 0.761 1e-49
332375346 322 unknown [Dendroctonus ponderosae] 0.680 0.403 0.705 1e-48
>gi|307202922|gb|EFN82142.1| Nuclear transcription factor Y subunit gamma [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 130/165 (78%), Gaps = 7/165 (4%)

Query: 15  VTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNK 74
           +T +DLKTQ+LPLARIKKIMKLD  VKMISAEAPMLFSKAAE+FIHELT+RAW+HTEDNK
Sbjct: 49  ITTMDLKTQSLPLARIKKIMKLDGDVKMISAEAPMLFSKAAEIFIHELTLRAWVHTEDNK 108

Query: 75  RRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNPDQVQYYFQLA 134
           RRTLQRNDIAMAITKYD FDFLIDIVPR+E+K +    + +   +T++N DQV YYFQLA
Sbjct: 109 RRTLQRNDIAMAITKYDQFDFLIDIVPRDELKQSKA--QTESTVRTSMNSDQVHYYFQLA 166

Query: 135 QQHQAALQQNNQGATTTSATPTLVVNGGNSGAQQIQTIPMLLPLR 179
           QQ QA+  QN Q ++ T+A P  +V      A QIQTI +  P+ 
Sbjct: 167 QQ-QASANQNVQ-SSNTAAQPIQIV---QPSAGQIQTINIGSPVE 206

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|66498993|ref|XP_392156.2| PREDICTED: nuclear transcription factor Y subunit gamma-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380013245|ref|XP_003690675.1| PREDICTED: LOW QUALITY PROTEIN: nuclear transcription factor Y subunit gamma-like [Apis florea] Back     alignment and taxonomy information
>gi|307180253|gb|EFN68286.1| Nuclear transcription factor Y subunit gamma [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383860596|ref|XP_003705775.1| PREDICTED: nuclear transcription factor Y subunit gamma-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350425504|ref|XP_003494142.1| PREDICTED: LOW QUALITY PROTEIN: nuclear transcription factor Y subunit gamma-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728976|ref|XP_003402787.1| PREDICTED: nuclear transcription factor Y subunit gamma-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332022675|gb|EGI62956.1| Nuclear transcription factor Y subunit gamma [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242247387|ref|NP_001156138.1| nuclear transcription factor Y, gamma-like [Acyrthosiphon pisum] gi|239792502|dbj|BAH72587.1| ACYPI003442 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332375346|gb|AEE62814.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
UNIPROTKB|F1P0P8 338 NFYC "Uncharacterized protein" 0.586 0.331 0.663 4.4e-36
UNIPROTKB|Q5E9X1 335 NFYC "Nuclear transcription fa 0.586 0.334 0.655 9.2e-36
UNIPROTKB|F1Q380 335 NFYC "Uncharacterized protein" 0.586 0.334 0.655 9.2e-36
UNIPROTKB|F8VWM3 334 NFYC "Nuclear transcription fa 0.586 0.335 0.655 9.2e-36
UNIPROTKB|Q13952 458 NFYC "Nuclear transcription fa 0.586 0.244 0.655 9.2e-36
UNIPROTKB|Q5T6K5 313 NFYC "Nuclear transcription fa 0.586 0.357 0.655 9.2e-36
UNIPROTKB|F1SF75 335 NFYC "Uncharacterized protein" 0.586 0.334 0.655 9.2e-36
MGI|MGI:107901 335 Nfyc "nuclear transcription fa 0.586 0.334 0.655 9.2e-36
RGD|3173 335 Nfyc "nuclear transcription fa 0.586 0.334 0.655 9.2e-36
UNIPROTKB|Q62725 335 Nfyc "Nuclear transcription fa 0.586 0.334 0.655 9.2e-36
UNIPROTKB|F1P0P8 NFYC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 389 (142.0 bits), Expect = 4.4e-36, P = 4.4e-36
 Identities = 77/116 (66%), Positives = 94/116 (81%)

Query:     9 VNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWI 68
             +  +  +T  D + Q LPLARIKKIMKLD+ VKMISAEAP+LF+KAA++FI ELT+RAWI
Sbjct:    30 MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWI 89

Query:    69 HTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPREEVKTATGPHRRDDATKTALNP 124
             HTEDNKRRTLQRNDIAMAITK+D FDFLIDIVPR+E+K    P +R +  + A+ P
Sbjct:    90 HTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELK----PPKRQEEVRQAVTP 141
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0016602 "CCAAT-binding factor complex" evidence=IEA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IEA
UNIPROTKB|Q5E9X1 NFYC "Nuclear transcription factor Y subunit gamma" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q380 NFYC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8VWM3 NFYC "Nuclear transcription factor Y subunit gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13952 NFYC "Nuclear transcription factor Y subunit gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T6K5 NFYC "Nuclear transcription factor Y subunit gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SF75 NFYC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:107901 Nfyc "nuclear transcription factor-Y gamma" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3173 Nfyc "nuclear transcription factor-Y gamma" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62725 Nfyc "Nuclear transcription factor Y subunit gamma" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q62725NFYC_RATNo assigned EC number0.69670.61250.3492yesN/A
Q5RA23NFYC_PONABNo assigned EC number0.70240.61780.3522yesN/A
Q5E9X1NFYC_BOVINNo assigned EC number0.69670.61250.3492yesN/A
P79007HAP5_SCHPONo assigned EC number0.57840.50780.2337yesN/A
Q02516HAP5_YEASTNo assigned EC number0.66660.43970.3471yesN/A
P70353NFYC_MOUSENo assigned EC number0.69670.61250.3492yesN/A
Q13952NFYC_HUMANNo assigned EC number0.69670.61250.2554yesN/A
Q9FMV5NFYC4_ARATHNo assigned EC number0.73860.46070.352yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
COG5208286 COG5208, HAP5, CCAAT-binding factor, subunit C [Tr 3e-39
pfam0080865 pfam00808, CBFD_NFYB_HMF, Histone-like transcripti 3e-20
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 6e-10
COG5247113 COG5247, BUR6, Class 2 transcription repressor NC2 4e-07
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 1e-05
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 9e-05
>gnl|CDD|227533 COG5208, HAP5, CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information 
 Score =  134 bits (339), Expect = 3e-39
 Identities = 59/98 (60%), Positives = 77/98 (78%)

Query: 6   KEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIR 65
           ++ +    +  ++ LK   LPLARIKK+MK D+ VKMISAEAP+LF+K  E+FI ELT+R
Sbjct: 91  QQTIKAAEEERQILLKDHNLPLARIKKVMKTDEDVKMISAEAPVLFAKITEIFIEELTMR 150

Query: 66  AWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPRE 103
           AWI+ E+NKRRTLQ++DIA A+ K +MFDFLIDIVPR 
Sbjct: 151 AWINAEENKRRTLQKSDIAAAVKKSEMFDFLIDIVPRN 188

Length = 286
>gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 99.92
KOG1657|consensus236 99.92
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 99.82
KOG1659|consensus224 99.8
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 99.77
KOG1658|consensus162 99.35
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 99.29
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 99.23
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.01
smart00414106 H2A Histone 2A. 99.01
PLN00154136 histone H2A; Provisional 98.97
KOG1756|consensus131 98.96
PTZ00017134 histone H2A; Provisional 98.96
KOG0869|consensus168 98.91
PLN00156139 histone H2AX; Provisional 98.84
PLN00153129 histone H2A; Provisional 98.84
smart0080365 TAF TATA box binding protein associated factor. TA 98.83
PLN00157132 histone H2A; Provisional 98.82
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 98.78
cd0007685 H4 Histone H4, one of the four histones, along wit 98.76
PLN00035103 histone H4; Provisional 98.76
KOG0870|consensus172 98.76
PTZ00252134 histone H2A; Provisional 98.73
PTZ00015102 histone H4; Provisional 98.65
smart0041774 H4 Histone H4. 98.62
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 98.2
KOG0871|consensus156 98.18
smart00428105 H3 Histone H3. 97.96
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 97.75
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 97.65
COG5150148 Class 2 transcription repressor NC2, beta subunit 97.6
smart0057677 BTP Bromodomain transcription factors and PHD doma 97.56
KOG1757|consensus131 97.47
KOG1658|consensus162 97.42
PLN00161135 histone H3; Provisional 97.4
PLN0016097 histone H3; Provisional 97.39
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 97.31
PF0296966 TAF: TATA box binding protein associated factor (T 97.28
PLN00121136 histone H3; Provisional 97.26
PTZ00018136 histone H3; Provisional 97.21
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 97.21
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 96.89
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 96.84
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 96.42
KOG3467|consensus103 96.18
smart0042789 H2B Histone H2B. 96.0
KOG1745|consensus137 95.6
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 95.6
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 95.44
KOG3219|consensus195 95.44
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 95.39
PLN0015558 histone H2A; Provisional 95.27
PLN00158116 histone H2B; Provisional 94.78
PF15510102 CENP-W: Centromere kinetochore component W 94.77
PTZ00463117 histone H2B; Provisional 94.38
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 93.72
KOG1744|consensus127 93.44
KOG1142|consensus258 91.85
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 91.41
KOG3423|consensus176 89.03
PF05236264 TAF4: Transcription initiation factor TFIID compon 88.68
KOG2549|consensus 576 87.63
PF0354051 TFIID_30kDa: Transcription initiation factor TFIID 87.39
cd08045212 TAF4 TATA Binding Protein (TBP) Associated Factor 87.12
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information 
Probab=99.92  E-value=3.6e-26  Score=196.44  Aligned_cols=100  Identities=59%  Similarity=0.908  Sum_probs=94.4

Q ss_pred             hhhhhhhhhhc-ccccccCCCCChHHHHHHHhcCCCccccCccHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCeeCHHHH
Q psy14772          5 EKEHVNRVIQV-TELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDI   83 (191)
Q Consensus         5 ~~p~~~~e~~~-~~~d~k~~~LPlARIKKIMK~D~DV~~IS~EA~vliakAtElFI~~La~~A~~~A~~~kRKTI~~~DI   83 (191)
                      .|-+...++.. ...+++.+.||+|||||+||.|+||++||+|||++++|+||.||++|+-+||-+|+++|||||+.+||
T Consensus        89 yWq~ti~~~e~~~q~~~k~h~LPlARIkkvMKtdedVkMisaEaPvlFak~~EiFI~ELTmRAW~~ae~NkRRtLQksDi  168 (286)
T COG5208          89 YWQQTIKAAEEERQILLKDHNLPLARIKKVMKTDEDVKMISAEAPVLFAKITEIFIEELTMRAWINAEENKRRTLQKSDI  168 (286)
T ss_pred             HHHHHHHHHHHhHHHHHHhccCcHHHHHHHHhcccchhheecccchHHHHHHHHHHHHHHHHHHHHHhHhhhhHHHHHHH
Confidence            68888888883 34778999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCccccccccCCCcc
Q psy14772         84 AMAITKYDMFDFLIDIVPREE  104 (191)
Q Consensus        84 a~AV~~~e~fdFL~DiVP~~~  104 (191)
                      +.||++.|.||||.||||+.-
T Consensus       169 a~Av~kSeMfDFLidivpr~p  189 (286)
T COG5208         169 AAAVKKSEMFDFLIDIVPRNP  189 (286)
T ss_pred             HHHHHHHHHHhHHhhhccCCC
Confidence            999999999999999999874

>KOG1657|consensus Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>KOG1659|consensus Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>KOG1658|consensus Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>KOG1756|consensus Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>KOG0869|consensus Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>KOG0870|consensus Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG0871|consensus Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>KOG1757|consensus Back     alignment and domain information
>KOG1658|consensus Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>PTZ00018 histone H3; Provisional Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>KOG3467|consensus Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>KOG3219|consensus Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PF15510 CENP-W: Centromere kinetochore component W Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1744|consensus Back     alignment and domain information
>KOG1142|consensus Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>KOG3423|consensus Back     alignment and domain information
>PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site Back     alignment and domain information
>KOG2549|consensus Back     alignment and domain information
>PF03540 TFIID_30kDa: Transcription initiation factor TFIID 23-30kDa subunit; InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors Back     alignment and domain information
>cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1n1j_B97 Crystal Structure Of The Nf-YbNF-Yc Histone Pair Le 3e-37
4awl_C94 The Nf-y Transcription Factor Is Structurally And F 9e-37
4g91_C119 Ccaat-Binding Complex From Aspergillus Nidulans Len 1e-31
2byk_A140 Histone Fold Heterodimer Of The Chromatin Accessibi 6e-05
1jfi_A98 Crystal Structure Of The Nc2-Tbp-Dna Ternary Comple 1e-04
>pdb|1N1J|B Chain B, Crystal Structure Of The Nf-YbNF-Yc Histone Pair Length = 97 Back     alignment and structure 
Iteration: 1

 Score =  151 bits (381), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 72/95 (75%), Positives = 83/95 (87%)
Query: 8   HVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAW 67
           H+  +  +T  D + Q LPLARIKKIMKLD+ VKMISAEAP+LF+KAA++FI ELT+RAW
Sbjct: 3   HMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAW 62
Query: 68  IHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPR 102
           IHTEDNKRRTLQRNDIAMAITK+D FDFLIDIVPR
Sbjct: 63  IHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR 97
>pdb|4AWL|C Chain C, The Nf-y Transcription Factor Is Structurally And Functionally A Sequence Specific Histone Length = 94 Back     alignment and structure
>pdb|4G91|C Chain C, Ccaat-Binding Complex From Aspergillus Nidulans Length = 119 Back     alignment and structure
>pdb|2BYK|A Chain A, Histone Fold Heterodimer Of The Chromatin Accessibility Complex Length = 140 Back     alignment and structure
>pdb|1JFI|A Chain A, Crystal Structure Of The Nc2-Tbp-Dna Ternary Complex Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 5e-35
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 4e-32
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 2e-30
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 9e-20
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 7e-19
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 4e-11
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 6e-11
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 2e-10
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
 Score =  118 bits (296), Expect = 5e-35
 Identities = 71/89 (79%), Positives = 80/89 (89%)

Query: 14  QVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDN 73
            +T  D + Q LPLARIKKIMKLD+ VKMISAEAP+LF+KAA++FI ELT+RAWIHTEDN
Sbjct: 9   NLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDN 68

Query: 74  KRRTLQRNDIAMAITKYDMFDFLIDIVPR 102
           KRRTLQRNDIAMAITK+D FDFLIDIVPR
Sbjct: 69  KRRTLQRNDIAMAITKFDQFDFLIDIVPR 97
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Length = 128 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 93 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 179 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Length = 68 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.97
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.97
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.94
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 99.93
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 99.82
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.8
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.63
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 99.62
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 99.52
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 99.49
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 99.47
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 99.46
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 99.45
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 99.43
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 99.42
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.32
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 99.25
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.24
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 99.16
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.13
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.09
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.08
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 99.03
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 98.99
1taf_B70 TFIID TBP associated factor 62; transcription init 98.69
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 98.26
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 98.13
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 98.12
1taf_A68 TFIID TBP associated factor 42; transcription init 98.11
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 98.04
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 98.04
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 98.03
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 97.9
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 97.87
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 97.8
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 97.79
3r45_A156 Histone H3-like centromeric protein A; histone fol 97.77
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 97.75
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.6
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 97.2
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 97.14
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 96.99
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 96.9
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 96.65
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 96.51
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 96.41
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 95.05
3v9r_B88 MHF2, uncharacterized protein YDL160C-A; histone f 94.6
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 84.51
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
Probab=99.97  E-value=1.3e-31  Score=208.54  Aligned_cols=99  Identities=65%  Similarity=0.960  Sum_probs=96.0

Q ss_pred             hhhhhhhhhhhcccccccCCCCChHHHHHHHhcCCCccccCccHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCeeCHHHH
Q psy14772          4 GEKEHVNRVIQVTELDLKTQALPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDI   83 (191)
Q Consensus         4 ~~~p~~~~e~~~~~~d~k~~~LPlARIKKIMK~D~DV~~IS~EA~vliakAtElFI~~La~~A~~~A~~~kRKTI~~~DI   83 (191)
                      .+|.+.++||+....|++.+.||+||||||||.|||+++||++|++++++|||+||.+|+.+|+.+|+.+|||||+|+||
T Consensus        21 ~fw~~~~~~~e~~~~d~k~~~lPvaRIkrImK~d~~~~~is~eA~v~la~a~E~Fi~~L~~~A~~~a~~~krktI~~~di  100 (119)
T 4g92_C           21 TYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDI  100 (119)
T ss_dssp             HHHHHHHHHHTCSCCCSSCCSSCHHHHHHHHHTSTTCCEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHH
T ss_pred             HHHHHHHHHHHhcccccccCCCCHHHHHHHHhhCCccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCccCHHHH
Confidence            47999999999888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCccccccccCCC
Q psy14772         84 AMAITKYDMFDFLIDIVPR  102 (191)
Q Consensus        84 a~AV~~~e~fdFL~DiVP~  102 (191)
                      +.||++.|.|+||.|+||+
T Consensus       101 ~~Av~~~e~~dFL~DiVPk  119 (119)
T 4g92_C          101 AAALSKSDMFDFLIDIVPR  119 (119)
T ss_dssp             HHHHTTCGGGGGGTTTCC-
T ss_pred             HHHHhcCchhhHHHHhCCC
Confidence            9999999999999999996
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 2e-30
d2byka172 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophil 5e-26
d1n1ja_87 a.22.1.3 (A:) Nuclear transcription factor Y subun 6e-23
d2bykb189 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila 1e-22
d1jfib_135 a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain 7e-22
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 4e-21
d1htaa_68 a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth 3e-19
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 8e-19
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 1e-06
d1ku5a_66 a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc 2e-18
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 9e-07
d2huec182 a.22.1.1 (C:20-101) Histone H4 {African clawed fro 2e-04
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Nuclear transcription factor Y subunit gamma (Nf-Yc2)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  104 bits (260), Expect = 2e-30
 Identities = 68/78 (87%), Positives = 75/78 (96%)

Query: 25  LPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIA 84
           LPLARIKKIMKLD+ VKMISAEAP+LF+KAA++FI ELT+RAWIHTEDNKRRTLQRNDIA
Sbjct: 1   LPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIA 60

Query: 85  MAITKYDMFDFLIDIVPR 102
           MAITK+D FDFLIDIVPR
Sbjct: 61  MAITKFDQFDFLIDIVPR 78
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 89 Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 99.95
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 99.9
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.88
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 99.86
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 99.82
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 99.8
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 99.76
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 99.69
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.53
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 98.97
d1q9ca_172 Histone domain of Son of sevenless protein {Human 98.94
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 98.91
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 98.91
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.88
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 98.75
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 97.95
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 97.15
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 96.42
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 93.58
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 91.57
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 86.82
d1h3oa_50 TAF(II)-135, (TAF(II)-130, hTAF4), histone fold do 82.34
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 80.54
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Nuclear transcription factor Y subunit gamma (Nf-Yc2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=7.7e-29  Score=176.91  Aligned_cols=78  Identities=87%  Similarity=1.291  Sum_probs=77.1

Q ss_pred             CChHHHHHHHhcCCCccccCccHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCeeCHHHHHHHHhcCCccccccccCCC
Q psy14772         25 LPLARIKKIMKLDDGVKMISAEAPMLFSKAAELFIHELTIRAWIHTEDNKRRTLQRNDIAMAITKYDMFDFLIDIVPR  102 (191)
Q Consensus        25 LPlARIKKIMK~D~DV~~IS~EA~vliakAtElFI~~La~~A~~~A~~~kRKTI~~~DIa~AV~~~e~fdFL~DiVP~  102 (191)
                      ||+||||||||.|||+.+||+||++++++|+|+|+++|+..|++.|+.+|||||+|+||+.||++.+.|+||.|+||+
T Consensus         1 LP~srVkrImK~~~~~~~is~ea~~~i~~a~E~Fi~~l~~~A~~~a~~~~rkti~~~dl~~av~~~~~~~FL~d~vPk   78 (78)
T d1n1jb_           1 LPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR   78 (78)
T ss_dssp             CCHHHHHHHHTTSTTCCCBCTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHTTCGGGGGGTTTSCC
T ss_pred             CCHHHHHHHHhcCCcccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcCCHHHHHHHHhcCChhHHHHHhCCC
Confidence            899999999999999999999999999999999999999999999999999999999999999999999999999996
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1h3oa_ a.22.1.3 (A:) TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure