Diaphorina citri psyllid: psy14775

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD
ccccEEEEEcccccHHHHHHHHHcHHHHHHHHHccccEEEEEECcccccccccccccEEEEEEccccHHHHHHHccEEEEEccccHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccEEEEEcc
*ALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-N-acetylglucosamine transferase subunit alg13 Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway.confidentO14190
UDP-N-acetylglucosamine transferase subunit ALG13 homolog May be involved in protein N-glycosylation, second step of the dolichol-linked oligosaccharide pathway.confidentQ5I0K7
UDP-N-acetylglucosamine transferase subunit ALG13 Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway.confidentP53178

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.141N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JZC, chain A
Confidence level:very confident
Coverage over the Query: 2-128
View the alignment between query and template
View the model in PyMOL